PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.008G284100.1
Common NamePHAVU_008G284100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family SAP
Protein Properties Length: 469aa    MW: 51901.5 Da    PI: 7.0501
Description SAP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.008G284100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SAP6404.4e-19514631454
                 SAP   1 mssssssssseseegseggeggdass............gesegpsssrqraanevwpePflealatqvaidasrslGrlaaasalanvfqv 79 
                         mss++sssss+s+++ ++++++d  +             ++egpsssrqra+nev+pePfleala q+a+ a++++Grlaaa+alan+fqv
  Phvul.008G284100.1   1 MSSTTSSSSSSSTSS-STSTPYDVVAadvpgpstrrttAQFEGPSSSRQRAMNEVLPEPFLEALANQLALHAANYNGRLAAAPALANLFQV 90 
                         788777777766655.577788877778999******99**************************************************** PP

                 SAP  80 cstwravsrsdllwqrltrriWrrtkllrdtWreeyiyrhrtarnfrtrrysyvtlqfdpadvdedndadalsCrclalsdkylaaGfadG 170
                         cstwr+vsrsdllw++ltrriWrrt ++rdtW+ eyi  hrtarnf+ +r s   +qf  +     ++  +l+Crcl lsd+ la+Gf+dG
  Phvul.008G284100.1  91 CSTWREVSRSDLLWEHLTRRIWRRTFRVRDTWHREYINCHRTARNFEDGRLSSSIPQFGHS-----EHRRSLICRCLVLSDTRLACGFVDG 176
                         **********************************************************996.....45689******************** PP

                 SAP 171 avrlfdletrlhvstflpqhrdrlGrfsravsGivisdsrlvfatldGdihvavidgagaaaarrallGdvvndGalvdfaGsgrWwvGly 261
                         +vr+fdlet++hvstfl++h++++G+fsr++sGivi+ds+++fa+ldGdi+v++i+++g+++arra+ G v+n+G lv faG+ rWwvGl+
  Phvul.008G284100.1 177 TVRVFDLETNAHVSTFLSDHGHLFGPFSRSISGIVITDSNITFARLDGDIYVDAINVHGQSQARRAVSGFVMNNGPLVGFAGTRRWWVGLF 267
                         ******************************************************************************************* PP

                 SAP 262 aGvpGrafhiWdaeteelvfvGGsltdPeavmGWhmlteltelvGrvrvteretavaCtslrlvvfdlrnqgvvlreeeerrGlivsslda 352
                         aG++Gr+f++W+ae+ e vfvGGsltdPe+vmGWhmltel++ v rvrvte e++vaCt lrlv+f+  n++v+lr+  +++G++v s+d+
  Phvul.008G284100.1 268 AGIAGRSFQVWNAESGESVFVGGSLTDPETVMGWHMLTELVDPVARVRVTEGEFVVACTGLRLVCFNAWNPEVLLRDAVSASGFVVNSMDV 358
                         ******************************************************************************************* PP

                 SAP 353 sneayvvvdsrGvatvrrvenleevcrfrvrg.aqrgvlgCvnggyalvyagg...vlrvWeiekkeg.ylyslrervgevnalvaddrhv 438
                         s+ea+vvv++ Gv+tv rv ++e ++rfr+rg + rg++gC+n+gy+l+y++     lrvW+ie++eg +++ +  r+gev ++va++ h+
  Phvul.008G284100.1 359 SEEAFVVVERGGVGTVWRVGTMELMSRFRLRGsWVRGLWGCMNLGYVLTYSPNpapFLRVWNIEQEEGrLCVRVFLRAGEVSSMVAHHSHM 449
                         ***************************************************998899********9999*********************9 PP

                 SAP 439 avsssdgtihlldfga 454
                         a ss  ++i+lldfg+
  Phvul.008G284100.1 450 AFSS--NNINLLDFGV 463
                         8776..57*******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.1280.509.2E-882155No hitNo description
SuperFamilySSF813833.92E-883131IPR001810F-box domain
SuperFamilySSF509781.19E-10146229IPR017986WD40-repeat-containing domain
Gene3DG3DSA:2.130.10.102.1E-9156218IPR015943WD40/YVTN repeat-like-containing domain
Gene3DG3DSA:2.130.10.102.1E-9266450IPR015943WD40/YVTN repeat-like-containing domain
SuperFamilySSF509781.19E-10294453IPR017986WD40-repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009908Biological Processflower development
GO:0030163Biological Processprotein catabolic process
GO:0046622Biological Processpositive regulation of organ growth
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 469 aa     Download sequence    Send to blast
MSSTTSSSSS SSTSSSTSTP YDVVAADVPG PSTRRTTAQF EGPSSSRQRA MNEVLPEPFL  60
EALANQLALH AANYNGRLAA APALANLFQV CSTWREVSRS DLLWEHLTRR IWRRTFRVRD  120
TWHREYINCH RTARNFEDGR LSSSIPQFGH SEHRRSLICR CLVLSDTRLA CGFVDGTVRV  180
FDLETNAHVS TFLSDHGHLF GPFSRSISGI VITDSNITFA RLDGDIYVDA INVHGQSQAR  240
RAVSGFVMNN GPLVGFAGTR RWWVGLFAGI AGRSFQVWNA ESGESVFVGG SLTDPETVMG  300
WHMLTELVDP VARVRVTEGE FVVACTGLRL VCFNAWNPEV LLRDAVSASG FVVNSMDVSE  360
EAFVVVERGG VGTVWRVGTM ELMSRFRLRG SWVRGLWGCM NLGYVLTYSP NPAPFLRVWN  420
IEQEEGRLCV RVFLRAGEVS SMVAHHSHMA FSSNNINLLD FGVHDEEP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150360.0AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007142480.10.0hypothetical protein PHAVU_008G284100g
TrEMBLV7B9G40.0V7B9G4_PHAVU; Uncharacterized protein
STRINGGLYMA14G01280.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF76873146
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35770.14e-94SAP family protein