PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.008G268500.1
Common NamePHAVU_008G268500g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family LBD
Protein Properties Length: 158aa    MW: 17746.1 Da    PI: 8.2836
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.008G268500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260123.61e-3851051101
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk +rr+C++dC+++p+fpa++p++fa vhk++G snv k+l+++p+  re++++sl++eA++r++dPvyG+vg+i+kl +++++++
  Phvul.008G268500.1   5 RCAACKNQRRRCPSDCIFSPHFPANDPQRFASVHKIYGGSNVGKMLQQIPPYLREQTANSLYFEAQCRIQDPVYGCVGIISKLYEEIRNTE 95 
                         6****************************************************************************************** PP

              DUF260  92 aelallkeel 101
                         +ela++++++
  Phvul.008G268500.1  96 TELAQIQTQI 105
                         ****999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.3024105IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-385102IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MISGRCAACK NQRRRCPSDC IFSPHFPAND PQRFASVHKI YGGSNVGKML QQIPPYLREQ  60
TANSLYFEAQ CRIQDPVYGC VGIISKLYEE IRNTETELAQ IQTQITCHKL KVVQANNNAE  120
TNMNLLSTVG TGTNFQIPAP STNPTEFQWP NQVPWFH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-34610512111LOB family transfactor Ramosa2.1
5ly0_B8e-34610512111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.008G268500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150361e-77AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007142295.11e-116hypothetical protein PHAVU_008G268500g
SwissprotP594686e-45LBD24_ARATH; LOB domain-containing protein 24
TrEMBLV7B9031e-115V7B903_PHAVU; Uncharacterized protein
STRINGXP_007142295.11e-116(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.12e-47LOB domain-containing protein 24