PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.008G257400.1
Common NamePHAVU_008G257400g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family LBD
Protein Properties Length: 123aa    MW: 13608.8 Da    PI: 8.0324
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.008G257400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.32.3e-4271071101
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +Ca+Ck+lrr+C++dC++apyfp+++  +fa+vhk+FG sn++k+lk++p ++r da++slvyeA+ar+r+PvyG+vg+i++l+ q+++l+
  Phvul.008G257400.1   7 PCASCKFLRRRCSQDCIFAPYFPSNDLCNFAIVHKVFGCSNIIKMLKDVPVDQRGDAVKSLVYEANARVRNPVYGCVGIISNLEIQVSELQ 97 
                         7****************************************************************************************** PP

              DUF260  92 aelallkeel 101
                          +la+++ee+
  Phvul.008G257400.1  98 MQLAVVQEEI 107
                         *****99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.2286107IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-427104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 123 aa     Download sequence    Send to blast
MGGNSSPCAS CKFLRRRCSQ DCIFAPYFPS NDLCNFAIVH KVFGCSNIIK MLKDVPVDQR  60
GDAVKSLVYE ANARVRNPVY GCVGIISNLE IQVSELQMQL AVVQEEILSI KKQQEFTFTN  120
AI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150364e-77AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007142160.12e-86hypothetical protein PHAVU_008G257400g
SwissprotQ8LBW31e-56LBD12_ARATH; LOB domain-containing protein 12
TrEMBLV7B8M13e-86V7B8M1_PHAVU; Uncharacterized protein
STRINGGLYMA18G02780.15e-57(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.16e-58LBD family protein