PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.008G249100.1
Common NamePHAVU_008G249100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family LBD
Protein Properties Length: 262aa    MW: 28467.7 Da    PI: 9.6959
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.008G249100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.71.5e-41621611100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+Ca++C+++pyf  ++p+kf +vhk+FGasnv+k+l ++pe +r da++slvyeA+ r+rdPvyG++g i++lqqq+++l+
  Phvul.008G249100.1  62 PCAACKLLRRRCAEECPFSPYFSPHEPQKFVAVHKVFGASNVSKMLLEVPEGQRADAANSLVYEANLRLRDPVYGCMGAISALQQQVQSLQ 152
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         ael++++ee
  Phvul.008G249100.1 153 AELNAIREE 161
                         ****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.44461162IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-4162159IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MKQNLSPSQH TLIKKIKRHV WTSRDRLDEI TKIRAEVEAS SQMGRKHFYG PIPGITLNTV  60
TPCAACKLLR RRCAEECPFS PYFSPHEPQK FVAVHKVFGA SNVSKMLLEV PEGQRADAAN  120
SLVYEANLRL RDPVYGCMGA ISALQQQVQS LQAELNAIRE EILKYKYREA ASLISSNHAA  180
LVSSADAISA AIPANSQPQG LSQLPPPPLP KQLPAPPLKP LPSPSVILSS FSSSSTSSVY  240
TPKSSMSLGS ISTTENVPYF V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-436217311122LOB family transfactor Ramosa2.1
5ly0_B1e-436217311122LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.008G249100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150360.0AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007142059.10.0hypothetical protein PHAVU_008G249100g
SwissprotQ9AT619e-73LBD13_ARATH; LOB domain-containing protein 13
TrEMBLV7BB150.0V7BB15_PHAVU; Uncharacterized protein
STRINGXP_007142059.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.15e-67LOB domain-containing protein 15
Publications ? help Back to Top
  1. Cho C,Jeon E,Pandey SK,Ha SH,Kim J
    LBD13 positively regulates lateral root formation in Arabidopsis.
    Planta, 2019. 249(4): p. 1251-1258
    [PMID:30627888]