PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.008G238900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family G2-like
Protein Properties Length: 452aa    MW: 49156.6 Da    PI: 8.5836
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.008G238900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.4e-32261314255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Phvul.008G238900.1 261 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 314
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.69E-15258314IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-28259314IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-23261314IPR006447Myb domain, plants
PfamPF002498.3E-7262313IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 452 aa     Download sequence    Send to blast
MTLEGIFIEP TSTTAPDLSL HISPPSISSS LISNYEPQAS FPSRTVSQAH TELSLGRNFT  60
SPRPTPRPTP TPHSPYYPGQ AHFHHLLHSS SASTSSNTAT SVAASTNTPL NHINYGVSLL  120
DVSSSDGLRP IKGIPVYHNR SFPFVAMDHA RDNKDPHNKM CLYHHVPSYP ALSSSSSSLC  180
STTASSSSPS PYFVDPMSFL NNGSTLACRA ATATRFNGFS GDAFKSHPLH QYGVGSSEAS  240
SGFMRSRFLS KLPNKRSMRA PRMRWTSTLH ARFVHAVELL GGHERATPKS VLELMDVKDL  300
TLAHVKSHLQ MYRTVKTTDK PAASSGHSDG SGEDDLSPIG STADRSSLRQ FPNHRGRPEW  360
VAQQDMDYSS TTTLWSNSSS CGESRQKTTS NDIDGLRSPI LLSQTISGVH QIQECDSTQQ  420
KNNMAGSNME CKNPSLEFTL GRPHWDGKEQ A*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-16262316458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-16262316458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-16262316357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-16262316357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-16262316357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-16262316357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-16262316458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-16262316458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-16262316458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-16262316458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-16262316458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-16262316458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.008G238900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150360.0AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007141941.10.0hypothetical protein PHAVU_008G2389000g, partial
TrEMBLV7B8M00.0V7B8M0_PHAVU; Uncharacterized protein (Fragment)
STRINGXP_007141941.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.12e-56G2-like family protein