PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.008G220900.1
Common NamePHAVU_008G220900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family LBD
Protein Properties Length: 158aa    MW: 17408.8 Da    PI: 6.6539
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.008G220900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.32.3e-4261051100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +C +Ck+lrrkC++dC++apyf +++p+kfa+vhk+FGasn++k+l++lp e+r da+sslvyeA ar+rdPvyG+vg i+ lq+q++ lk
  Phvul.008G220900.1   6 PCGSCKLLRRKCTEDCIFAPYFLSDDPQKFAIVHKVFGASNLSKMLQELPVEQRADAVSSLVYEASARVRDPVYGCVGAISYLQNQVADLK 96 
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                          +la++++e
  Phvul.008G220900.1  97 MQLAVAQAE 105
                         ****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.2935106IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-426103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MGGNPPCGSC KLLRRKCTED CIFAPYFLSD DPQKFAIVHK VFGASNLSKM LQELPVEQRA  60
DAVSSLVYEA SARVRDPVYG CVGAISYLQN QVADLKMQLA VAQAEIQCIQ IDKKSLIVPS  120
EETDLHNSDH LQNNFSQFPN FGTSNSVVHH PPNYLRP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150365e-65AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007141734.11e-115hypothetical protein PHAVU_008G220900g
SwissprotQ8LBW37e-63LBD12_ARATH; LOB domain-containing protein 12
TrEMBLV7BA481e-115V7BA48_PHAVU; Uncharacterized protein
STRINGGLYMA02G43030.13e-74(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.14e-64LBD family protein