PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.008G220900.1
Common NamePHAVU_008G220900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family LBD
Protein Properties Length: 158aa    MW: 17408.8 Da    PI: 6.6539
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.008G220900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.32.3e-4261051100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +C +Ck+lrrkC++dC++apyf +++p+kfa+vhk+FGasn++k+l++lp e+r da+sslvyeA ar+rdPvyG+vg i+ lq+q++ lk
  Phvul.008G220900.1   6 PCGSCKLLRRKCTEDCIFAPYFLSDDPQKFAIVHKVFGASNLSKMLQELPVEQRADAVSSLVYEASARVRDPVYGCVGAISYLQNQVADLK 96 
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                          +la++++e
  Phvul.008G220900.1  97 MQLAVAQAE 105
                         ****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.2935106IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-426103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MGGNPPCGSC KLLRRKCTED CIFAPYFLSD DPQKFAIVHK VFGASNLSKM LQELPVEQRA  60
DAVSSLVYEA SARVRDPVYG CVGAISYLQN QVADLKMQLA VAQAEIQCIQ IDKKSLIVPS  120
EETDLHNSDH LQNNFSQFPN FGTSNSVVHH PPNYLRP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-4421067111LOB family transfactor Ramosa2.1
5ly0_B3e-4421067111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.008G220900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150365e-65AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007141734.11e-115hypothetical protein PHAVU_008G220900g
SwissprotQ8LBW39e-62LBD12_ARATH; LOB domain-containing protein 12
TrEMBLV7BA481e-113V7BA48_PHAVU; Uncharacterized protein
STRINGXP_007141734.11e-114(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.14e-64LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]