PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.008G196200.1
Common NamePHAVU_008G196200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family G2-like
Protein Properties Length: 201aa    MW: 22911.1 Da    PI: 9.6042
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.008G196200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like93.71.5e-292679255
             G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        prlrWtp+LH++Fv+a++++GG++kAtPk+il+ m v gL+++h+kSHLQ+YR 
  Phvul.008G196200.1 26 PRLRWTPQLHQHFVQAIQSIGGKHKATPKRILQQMRVRGLSIAHIKSHLQMYRN 79
                        8****************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.042282IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.4E-272380IPR009057Homeodomain-like
SuperFamilySSF466893.05E-142680IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-242680IPR006447Myb domain, plants
PfamPF002492.1E-82778IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MKKAETQKKM KNCERSVRQY NKSELPRLRW TPQLHQHFVQ AIQSIGGKHK ATPKRILQQM  60
RVRGLSIAHI KSHLQMYRNM KDYAKNSADE LVEGNANDFK LCSISPTQRI ILKGELHLLD  120
NKKGLLQSTE ETDYDLNQEG QSSEEENVPN LLFSFSRPLI SMMQSDENSK DMMQFPSSTA  180
AAANHSITFG NSYINLDLTI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A7e-182781458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B7e-182781458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A7e-182781458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C7e-182781458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D7e-182781458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F7e-182781458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H7e-182781458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J7e-182781458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.008G196200.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150368e-52AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007141445.11e-150hypothetical protein PHAVU_008G196200g
TrEMBLV7B6J71e-148V7B6J7_PHAVU; Uncharacterized protein
STRINGXP_007141445.11e-149(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF91862839
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.11e-26G2-like family protein