PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.008G157100.1
Common NamePHAVU_008G157100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family SBP
Protein Properties Length: 345aa    MW: 37545.8 Da    PI: 9.0287
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.008G157100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.75.2e-41178255178
                         --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                 SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                         +CqvegC++ l +ak+yhrrhkvCe+hskap+v+v gleqrfCqqCsrfh +sefD++krsCrrrLa+hnerrrk+++
  Phvul.008G157100.1 178 RCQVEGCQVALLNAKDYHRRHKVCEMHSKAPKVVVLGLEQRFCQQCSRFHVVSEFDDSKRSCRRRLAGHNERRRKSSH 255
                         6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.2E-35174240IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.445176253IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.01E-38177258IPR004333Transcription factor, SBP-box
PfamPF031104.3E-32179252IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MEFGGNIFCL ANRDQNGNTN GNTFAWDSWQ TTTFNNNNNT TSRLVNAFNA PVTGVTAPET  60
SAANRPEAAG LASALMFLPQ NGGVLRHRQQ QQQQQHPYGG DGSHVHPDPH LMCLKLGKRH  120
YFEDASGSGT VSSAAASAAT ATTFGGGLVL GDKRGKGGYS GGGAAVKGVG LTTATVPRCQ  180
VEGCQVALLN AKDYHRRHKV CEMHSKAPKV VVLGLEQRFC QQCSRFHVVS EFDDSKRSCR  240
RRLAGHNERR RKSSHDSVAR NSSQGGCALS LLSSRSDSWL SPSDLSTRCS AALRELIAEN  300
RAAIMARQFV SDRDWHIQHH AMEDMKEIQP ESTYFPQQMF PQTQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-301792521184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.008G157100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007140980.10.0hypothetical protein PHAVU_008G157100g
SwissprotQ01JD15e-56SPL7_ORYSI; Squamosa promoter-binding-like protein 7
SwissprotQ7XT424e-56SPL7_ORYSJ; Squamosa promoter-binding-like protein 7
TrEMBLV7B5830.0V7B583_PHAVU; Uncharacterized protein
STRINGXP_007140980.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96132738
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.11e-35squamosa promoter binding protein-like 3
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]