PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.008G144700.3
Common NamePHAVU_008G144700g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family LBD
Protein Properties Length: 163aa    MW: 17981.2 Da    PI: 6.7447
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.008G144700.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.56.5e-4510108199
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrrkC +dC++apyfp e+p+kfanvhk+FGasnv+kll+++++++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l+
  Phvul.008G144700.3  10 PCAACKFLRRKCMPDCIFAPYFPPEEPQKFANVHKIFGASNVSKLLNEVQPHQREDAVNSLAYEAEARIKDPVYGCVGAISVLQRQVIRLQ 100
                         7****************************************************************************************** PP

              DUF260  92 aelallke 99 
                         +el+++++
  Phvul.008G144700.3 101 KELDATNA 108
                         ***99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.8819110IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-4410107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MASSSYSNSP CAACKFLRRK CMPDCIFAPY FPPEEPQKFA NVHKIFGASN VSKLLNEVQP  60
HQREDAVNSL AYEAEARIKD PVYGCVGAIS VLQRQVIRLQ KELDATNADL IRYTCNEIPT  120
QDGRRMGEGG GSSLGQSPGY YYPSPWNNDP LGDGYHRGDN NM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-6771188119LOB family transfactor Ramosa2.1
5ly0_B4e-6771188119LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.008G144700.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007140816.11e-120hypothetical protein PHAVU_008G144700g
RefseqXP_007140817.11e-120hypothetical protein PHAVU_008G144700g
RefseqXP_007140818.11e-120hypothetical protein PHAVU_008G144700g
SwissprotQ8L8Q36e-68LBD25_ARATH; LOB domain-containing protein 25
TrEMBLV7B4I61e-118V7B4I6_PHAVU; Uncharacterized protein
TrEMBLV7B5G21e-118V7B5G2_PHAVU; Uncharacterized protein
STRINGXP_007140818.11e-119(Phaseolus vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.12e-70LOB domain-containing protein 25
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]