PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.008G098300.1
Common NamePHAVU_008G098300g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family Trihelix
Protein Properties Length: 286aa    MW: 34431.8 Da    PI: 7.5053
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.008G098300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix80.42.5e-2547129186
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                         +W+ qe+++ + +r e+++++ ++k++k+lWe +s++m+e+gf+rs++qCk+kw+nl +ryk ++++e +     ++++p++++l+
  Phvul.008G098300.1  47 QWSIQETKEFLVIRAELDQTFMETKRNKQLWEVISNRMKEKGFHRSAEQCKCKWKNLVTRYKGCEAIETEA---MRQQFPFYNELQ 129
                         7********************************************************************85...56689****996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122031.12E-2046111No hitNo description
PfamPF138373.0E-2047129No hitNo description
PROSITE profilePS500907.31748104IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0016592Cellular Componentmediator complex
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MEGHHLHHHH HHRQQQHQQQ HQQQQQHHHP HNITTSANVD ATDRFPQWSI QETKEFLVIR  60
AELDQTFMET KRNKQLWEVI SNRMKEKGFH RSAEQCKCKW KNLVTRYKGC EAIETEAMRQ  120
QFPFYNELQG IFTSRMQRML WAEAEGGSKK KGVQLSSEDE EEGNEESEGD QKGSMMKKKK  180
KGKMVIGGGS SSNMESLKEI MEEFMRQQMQ MEAQWMEAFE ARENERRMKE MEWRQTMEAL  240
ENERMMMDQR WREREDQRRI REEVRADKRD ALITALLNKL RREEM*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00481DAPTransfer from AT5G01380Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007140273.10.0hypothetical protein PHAVU_008G098300g
SwissprotO804504e-71TGT3B_ARATH; Trihelix transcription factor GT-3b
SwissprotQ9SDW01e-70TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLV7B3010.0V7B301_PHAVU; Uncharacterized protein
STRINGGLYMA18G43190.21e-136(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.14e-54Trihelix family protein