PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.008G094800.1
Common NamePHAVU_008G094800g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family G2-like
Protein Properties Length: 365aa    MW: 40996.7 Da    PI: 7.127
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.008G094800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.33.1e-3268121255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         prlrWtp+LH rFv+av++LGG+e+AtPk +l+lm++kgL+++hvkSHLQ+YR+
  Phvul.008G094800.1  68 PRLRWTPDLHLRFVHAVQRLGGQERATPKLVLQLMNIKGLSIAHVKSHLQMYRS 121
                         8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.92964124IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-2964122IPR009057Homeodomain-like
SuperFamilySSF466891.2E-1467122IPR009057Homeodomain-like
TIGRFAMsTIGR015575.6E-2368123IPR006447Myb domain, plants
PfamPF002491.4E-969120IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MVMRMEEERH VSECSKTSPS NEEVCEESDE ENEDGSKRNN NGGSSSNSTV EENEKKATVR  60
PYVRSKLPRL RWTPDLHLRF VHAVQRLGGQ ERATPKLVLQ LMNIKGLSIA HVKSHLQMYR  120
SKKVEANQVL GDPRLLVETG DRNVYNLSQI PMLQGYNPSQ TSTFRYGYGD ASLAIYENMV  180
KRPCPNRSSA DEPGAEFCGS KLTERTHGTN SNINWSHNML QVDCSSFNEP STNKVHEPKH  240
KFFSIGGNES LCTQIKMSQD DLHQMQPSAQ ELMPNNKMTA NQMELNSLKR KASDTDIDLN  300
LSLKLSSRIS GDDRGSMVDH EIDSNLSLSL CSQSSSSYLS SRLRKSQDHS KEQGERARTL  360
DLTI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-1769123458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-1769123458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-1769123357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-1769123357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-1769123357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-1769123357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-1769123458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-1769123458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-1769123458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-1769123458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-1769123458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-1769123458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.008G094800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150371e-110AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007140226.10.0hypothetical protein PHAVU_008G094800g
TrEMBLV7B3U50.0V7B3U5_PHAVU; Uncharacterized protein
STRINGXP_007140226.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23783482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-51G2-like family protein