PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.008G072700.1
Common NamePHAVU_008G072700g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family HD-ZIP
Protein Properties Length: 817aa    MW: 89020 Da    PI: 6.4237
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.008G072700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.73.2e-21121176156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t++q++eLe+lF+++++p++++r eL+++l+L++rqVk+WFqNrR+++k
  Phvul.008G072700.1 121 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSRRLNLETRQVKFWFQNRRTQMK 176
                         688999***********************************************999 PP

2START204.15.7e-643325561206
                         HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
               START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                         ela++a++elvk+a+ +ep+W +s     e++n++e++++ ++  +     + +ea+r  g+v+ ++  lve+l+d++ +W+e+++    +
  Phvul.008G072700.1 332 ELALAAMDELVKMAQTGEPLWIRSLeggrEILNYEEYTRTMTPCIGlrpngFVTEASRQNGMVIINSLALVETLMDSN-RWSEMFPcmiaR 421
                         5899*************************************999989**99***************************.************ PP

                         EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEE CS
               START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghs 162
                          +t evis+g      galqlm aelq+lsplvp R++ f+R+++q+ +g w++vdvS+d  ++ +  + +v +++lpSg+++++++ng+s
  Phvul.008G072700.1 422 TSTAEVISNGingtrnGALQLMHAELQVLSPLVPvREVNFLRFCKQHAEGLWAVVDVSIDTIRETSGPPTFVNCRRLPSGCVVQDMPNGYS 512
                         ************************************************************9999988999********************* PP

                         EEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 163 kvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         kvtwveh++++++++h+l+r+l++sg+ +ga++wvatlqrqce+
  Phvul.008G072700.1 513 KVTWVEHAEYDESQVHQLYRPLLSSGTGFGAQRWVATLQRQCEC 556
                         ******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.3E-21104178IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-21108172IPR009057Homeodomain-like
PROSITE profilePS5007117.75118178IPR001356Homeobox domain
SMARTSM003891.1E-19119182IPR001356Homeobox domain
CDDcd000861.06E-19120178No hitNo description
PfamPF000468.0E-19121176IPR001356Homeobox domain
PROSITE patternPS000270153176IPR017970Homeobox, conserved site
PROSITE profilePS5084844.647323559IPR002913START domain
SuperFamilySSF559613.08E-34326556No hitNo description
CDDcd088751.84E-126327555No hitNo description
SMARTSM002346.0E-47332556IPR002913START domain
PfamPF018521.9E-55332556IPR002913START domain
SuperFamilySSF559611.21E-23584809No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 817 aa     Download sequence    Send to blast
MSFGGFLEAK QSGGGGRIVS DIPYSNGSNH SNDIMPSGAI SQPRLATPTL AKSMFNSPGL  60
SLALQSDVDG QGDMNRLMPE NFEQNGLRRS REEEHESRSG SDNMDGASGD DFDAADNPPR  120
KKRYHRHTPQ QIQELEALFK ECPHPDEKQR LELSRRLNLE TRQVKFWFQN RRTQMKTQLE  180
RHENSLLRQE NDKLRAENMS MREAMRNPMC SNCGGPAMIG EISLEEQHLR IENARLKDEL  240
DRVCALAGKF LGRPISSLTN SIGPPLPNSS LELGVGSNGF GGLSTVPSTL PDFGVGISSP  300
LAMMSPSTRP TATSTVVTPG LDRSVERSIV LELALAAMDE LVKMAQTGEP LWIRSLEGGR  360
EILNYEEYTR TMTPCIGLRP NGFVTEASRQ NGMVIINSLA LVETLMDSNR WSEMFPCMIA  420
RTSTAEVISN GINGTRNGAL QLMHAELQVL SPLVPVREVN FLRFCKQHAE GLWAVVDVSI  480
DTIRETSGPP TFVNCRRLPS GCVVQDMPNG YSKVTWVEHA EYDESQVHQL YRPLLSSGTG  540
FGAQRWVATL QRQCECLAIL MSSAVPSREH SAISSGGRRS MLKLAQRMTN NFCAGVCAST  600
VHKWNKLNAG NVGEDVRVMT RKSVDDPGEP PGIVLSAATS VWLPVSAQRL FDFLRDERLR  660
SEWDILSNGG PMQEMAHIAK GQDHANCVSL LRASAMNANQ SSMLILQETC TDASGSLVVY  720
APVDIPAMHV VMNGGDSAYV ALLPSGFAIV PDGSVSGGEH GGASQKRASG CLLTVAFQIL  780
VNSLPTAKLT VESVETVNNL ISCTVQKIKA ALHSES*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.008G072700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311660.0KT031166.1 Glycine max clone HN_CCL_121 homeodomain/HOMEOBOX transcription factor (Glyma09g40130.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007139955.10.0hypothetical protein PHAVU_008G072700g
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLV7B2980.0V7B298_PHAVU; Uncharacterized protein
STRINGXP_007139955.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]