PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.008G042200.1
Common NamePHAVU_008G042200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family HD-ZIP
Protein Properties Length: 269aa    MW: 30704.3 Da    PI: 6.5838
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.008G042200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.72e-1880132456
                         -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         + +++ eql++Le+ Fe  +++  e++ +LAk lgL+ rq+ +WFqNrRa++k
  Phvul.008G042200.1  80 KKRLNLEQLKALEKSFELANKLEPERKVQLAKALGLQPRQIAIWFQNRRARWK 132
                         4568889*********************************************9 PP

2HD-ZIP_I/II121.54.4e-3978170193
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekk+rl+ eq+k+LE+sFe  +kLeperKv+la++Lglqprq+a+WFqnrRAR+ktkqlEk+yeaLk++++  k++n+ L+ ++++L++el
  Phvul.008G042200.1  78 EKKKRLNLEQLKALEKSFELANKLEPERKVQLAKALGLQPRQIAIWFQNRRARWKTKQLEKEYEALKKQFEGAKADNDVLKIQNQKLQAEL 168
                         69***************************************************************************************99 PP

         HD-ZIP_I/II  92 ke 93 
                         ++
  Phvul.008G042200.1 169 EA 170
                         75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.56E-1973136IPR009057Homeodomain-like
PROSITE profilePS5007116.58474134IPR001356Homeobox domain
SMARTSM003899.8E-1777138IPR001356Homeobox domain
CDDcd000866.19E-1679135No hitNo description
PfamPF000462.1E-1580132IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.9E-1982142IPR009057Homeodomain-like
PRINTSPR000319.0E-6105114IPR000047Helix-turn-helix motif
PROSITE patternPS000270109132IPR017970Homeobox, conserved site
PRINTSPR000319.0E-6114130IPR000047Helix-turn-helix motif
PfamPF021835.3E-10134173IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MAFPPSHSFT FHTHEEDHHH LPSTSLNAYP SFPPQHFQGG APPFMLKRSM SFSGIENKCD  60
EVNGDDELSD DGNFQCGEKK KRLNLEQLKA LEKSFELANK LEPERKVQLA KALGLQPRQI  120
AIWFQNRRAR WKTKQLEKEY EALKKQFEGA KADNDVLKIQ NQKLQAELEA VKSRGWCEAG  180
TISLKKETEG SWSNGSENSS DINLDLSRTP ILNNPTSCQA PFPTSITQIL QYSSKPDFQD  240
DDFCNVIHNI DVQQNFWPWP GQQNHHFH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1126134RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.008G042200.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150371e-179AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007139587.10.0hypothetical protein PHAVU_008G042200g
SwissprotQ004661e-73HAT7_ARATH; Homeobox-leucine zipper protein HAT7
TrEMBLV7B5420.0V7B542_PHAVU; Uncharacterized protein
STRINGXP_007139587.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.13e-66homeobox 3