PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.007G260900.1
Common NamePHAVU_007G260900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family HD-ZIP
Protein Properties Length: 328aa    MW: 36312.9 Da    PI: 8.0371
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.007G260900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.42.1e-17157211256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         rk+ +++keq   Lee F+++ +++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Phvul.007G260900.1 157 RKKLRLSKEQSAFLEESFKEHTTLNPKQKLALAKQLNLLPRQVEVWFQNRRARTK 211
                         778899***********************************************98 PP

2HD-ZIP_I/II125.22.9e-40157247192
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         +kk+rlskeq+++LEesF+e+++L+p++K +la++L+l prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +l
  Phvul.007G260900.1 157 RKKLRLSKEQSAFLEESFKEHTTLNPKQKLALAKQLNLLPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELR-AL 246
                         69*************************************************************************************9.55 PP

         HD-ZIP_I/II  92 k 92 
                         k
  Phvul.007G260900.1 247 K 247
                         5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.11E-17149214IPR009057Homeodomain-like
PROSITE profilePS5007116.892153213IPR001356Homeobox domain
SMARTSM003891.2E-15155217IPR001356Homeobox domain
PfamPF000461.0E-14157211IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.9E-16157211IPR009057Homeodomain-like
CDDcd000862.72E-15157214No hitNo description
PROSITE patternPS000270188211IPR017970Homeobox, conserved site
SMARTSM003404.5E-26213256IPR003106Leucine zipper, homeobox-associated
PfamPF021836.5E-11213247IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MELALSLGDT SKSFAFLDKP VNLPSKDPPG FCIAPGKAFE DKRTDAEKRG SSDPPVQLDL  60
LPFTPVLRSQ PPSQLRIPWL TEPCGAARVL DVNLFPSAAE DGDDGTSLSS PSSAVSPFQM  120
DFSIRNGNAE FGGRNKREQQ EGEGTRVSDD EENGSTRKKL RLSKEQSAFL EESFKEHTTL  180
NPKQKLALAK QLNLLPRQVE VWFQNRRART KLKQTEVDCE YLKRCCETLT EENRRLQKEL  240
QELRALKTSQ PFYMQLPATT LTMCPSCERV ATNSTTTNQT SSTINNTASQ IPVELSLSKP  300
RILPFPNGQA QATQAQAQTQ AHRIASS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1155161TRKKLRL
2205213RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.007G260900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150411e-134AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007145700.10.0hypothetical protein PHAVU_007G260900g
SwissprotP466653e-91HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLV7BID90.0V7BID9_PHAVU; Uncharacterized protein
STRINGXP_007145700.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.14e-71homeobox from Arabidopsis thaliana