PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.007G258700.1
Common NamePHAVU_007G258700g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family G2-like
Protein Properties Length: 425aa    MW: 47042.9 Da    PI: 6.1822
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.007G258700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1001.5e-31251305155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+r+rWt+eLHe+Fve+v++LGG+ekAtPk+il+lm+ +gLt+ hvkSHLQkYR+
  Phvul.007G258700.1 251 KTRIRWTQELHEQFVECVNRLGGAEKATPKAILRLMESDGLTIFHVKSHLQKYRI 305
                         68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.914248308IPR017930Myb domain
SuperFamilySSF466892.69E-17249305IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-28250306IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-23251306IPR006447Myb domain, plants
PfamPF002498.9E-9255304IPR001005SANT/Myb domain
PfamPF143791.2E-20335381IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MNEYKIDCVG RIQQSYALNG DLSSEFSNCS SQYFDIIQAS NMGTFNQPLA MVSGEGVEQE  60
PHIGQTKSSS SIISRFESPA SAFYATEICM GFPQYDRLVG NPSLISQFSK ISDVEFPLYQ  120
SPRQNLFLAS LANQPAPNFE LSNPLQAMLL SHLNGDQCVR SPEKSNKIPC GNFPGSSFLP  180
IEQLKLFIDD AASPSIPSKG NQDQTDSCGS YNLPAAQISF SSQQEMLSPP LSAGSLLTSS  240
GNSTSNGPVS KTRIRWTQEL HEQFVECVNR LGGAEKATPK AILRLMESDG LTIFHVKSHL  300
QKYRIAKYMP QSTQGKSEKR INVENVHLDA KTGLQIREAL QLQLDVQRRL HEQLEIQRKL  360
QLRIEEQGKQ LKMMFDEQQK TSDSNLSTQN LGNTTNNDRT ISSKDVQVSI SEGSEKFLIP  420
SNIT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A7e-24251308259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B7e-24251308259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A6e-24251308158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-24251308158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-24251308158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-24251308158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A7e-24251308259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C7e-24251308259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D7e-24251308259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F7e-24251308259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H7e-24251308259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J7e-24251308259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.007G258700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007145673.10.0hypothetical protein PHAVU_007G258700g
SwissprotQ0WVU33e-69PHL5_ARATH; Myb family transcription factor PHL5
TrEMBLV7BIH10.0V7BIH1_PHAVU; Uncharacterized protein
STRINGXP_007145673.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37403465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.13e-70G2-like family protein