PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.007G244100.1
Common NamePHAVU_007G244100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family G2-like
Protein Properties Length: 228aa    MW: 25286.8 Da    PI: 8.9069
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.007G244100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.41.1e-3066119155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Phvul.007G244100.1  66 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 119
                         59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.05963122IPR017930Myb domain
SuperFamilySSF466891.7E-2063123IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.0E-3165124IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-2467119IPR006447Myb domain, plants
PfamPF002497.2E-869118IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MELPSPEELM PLSQTLITPH LAIAFHITNP SHNHHHQQFY SSQEPPQFPL QPPSAAEEEP  60
ARTLKRPRLV WTPQLHKRFV DAVAHLGIKN AVPKTIMQLM SVDGLTRENV ASHLQKYRLY  120
LKRMQGLAGG SAADSATDHL FASSPVPPHF LQATARSTSE HYLPFVPALQ PHRHHQQMAV  180
AAHFGSPRNA QFELPILSRI GASVPGYVED VESGRRKVLT LFPPGDD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A2e-3366122157Transcription factor LUX
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as a negative regulator of freezing tolerance via a CBF-independent pathway. {ECO:0000269|PubMed:20331973}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.007G244100.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought, salt and abscisic acid (ABA). Down-regulated by cold. {ECO:0000269|PubMed:20331973}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007145504.11e-165hypothetical protein PHAVU_007G244100g
SwissprotO222104e-54MYBC1_ARATH; Transcription factor MYBC1
TrEMBLV7BKD81e-164V7BKD8_PHAVU; Uncharacterized protein
STRINGXP_007145504.11e-165(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85423045
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G05090.15e-68G2-like family protein
Publications ? help Back to Top
  1. Sardesai N,Laluk K,Mengiste T,Gelvin S
    The Arabidopsis Myb transcription factor MTF1 is a unidirectional regulator of susceptibility to Agrobacterium.
    Plant Signal Behav, 2018.
    [PMID:24785741]