PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.007G190100.1
Common NamePHAVU_007G190100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family G2-like
Protein Properties Length: 472aa    MW: 51967.5 Da    PI: 5.3163
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.007G190100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1084.9e-34257311155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k r+rWtpeLHe+Fveav+qLGGse+AtPk +l+lmkv+gLt++hvkSHLQkYR+
  Phvul.007G190100.1 257 KSRMRWTPELHEAFVEAVNQLGGSERATPKGVLKLMKVEGLTIYHVKSHLQKYRT 311
                         68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.2E-18254311IPR009057Homeodomain-like
PROSITE profilePS5129413.523254314IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-31256313IPR009057Homeodomain-like
TIGRFAMsTIGR015578.3E-25257311IPR006447Myb domain, plants
PfamPF002494.4E-10259310IPR001005SANT/Myb domain
PfamPF143798.0E-26342389IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 472 aa     Download sequence    Send to blast
MEAHPTFSIE RSKQLNNMGM SGALSSSLSV LPIPSEDMYL RLPESQLDIV EQDLVTRPFT  60
HSSYLNSNGV VGHIFSSSPG YSTDLHHSSL SPDEKHSTNA HFISQSSTNI SQFPLSYSSN  120
TGPPNSATPS HFSKGNSASW HTGSLPNFLD FPAHDSIDDN RVESSACPIM ASEEYGKQND  180
WQEWAERLIS DDDTLTSNWD DLLTDNIQDI EPKVPFQVAK PLSQFPGHQC QGQQQLPASF  240
VDNCIGLSCS ANSTPAKSRM RWTPELHEAF VEAVNQLGGS ERATPKGVLK LMKVEGLTIY  300
HVKSHLQKYR TARYRPESSE GVTEKKGSSI EEMSSLDLKT GIEITEALRL QMEVQKRLHE  360
QLEIQRNLQL RIEEQGRYLQ MMFEKQCKSG TETLKASSST IETQSGVSSN ATRDFPVKSV  420
LEASQGPDQA NGSTPVEEGS LEKVGNPDSP KTQHAIASGD SAQAPKRQRT E*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-33256315160Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-33256315160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-33256315160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-33256315160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-33256315160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-33256315160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-33256315160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-33256315160Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.007G190100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007144858.10.0hypothetical protein PHAVU_007G190100g
RefseqXP_007144859.10.0hypothetical protein PHAVU_007G190100g
TrEMBLV7BG970.0V7BG97_PHAVU; Uncharacterized protein
STRINGXP_007144858.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15123498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.15e-97phosphate starvation response 1