PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.007G139300.1
Common NamePHAVU_007G139300g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family G2-like
Protein Properties Length: 311aa    MW: 33759.4 Da    PI: 6.7483
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.007G139300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.29.2e-343993155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprlrWt +LHerFv+av+qLGG+ kAtPk+i+++m+vkgLtl+h+kSHLQkYRl
  Phvul.007G139300.1 39 KPRLRWTADLHERFVDAVTQLGGASKATPKAIMRTMNVKGLTLYHLKSHLQKYRL 93
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-323694IPR009057Homeodomain-like
PROSITE profilePS5129410.7263696IPR017930Myb domain
TIGRFAMsTIGR015579.0E-243994IPR006447Myb domain, plants
SuperFamilySSF466891.08E-163995IPR009057Homeodomain-like
PfamPF002497.9E-84192IPR001005SANT/Myb domain
PfamPF143794.6E-13137182IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MFSRLIHPHE GGVAQEDMQA ASNHAHLGDP CLVLTSDPKP RLRWTADLHE RFVDAVTQLG  60
GASKATPKAI MRTMNVKGLT LYHLKSHLQK YRLGKQSGKD SDEGCKDGMS GSYLQESPGT  120
GNSSPNLPTS EANEGHEVKE ALRAQMEVQS KLHLLVEAEK HLQIRQDAER RYMGMLERAC  180
KMLADQFIGD MIMETDGQKF QGLESKTPRS SLVDHVGYFP PVCSEVGGMH VSEVAAILHP  240
QGADCSTESC LTSLESLGGL TLEGSPGGSK KRMLSLDSMV APLIWSEANT RTQGIHLGQV  300
NPPGITRYGM *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-193995258Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-193995258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-193995258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-193995258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-193995258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-193995258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-193995258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-193995258Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.007G139300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0951070.0BT095107.1 Soybean clone JCVI-FLGm-19M17 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007144235.10.0hypothetical protein PHAVU_007G139300g
TrEMBLV7BEH40.0V7BEH4_PHAVU; Uncharacterized protein
STRINGXP_007144235.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66183349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.19e-66G2-like family protein