PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.007G102900.1
Common NamePHAVU_007G102900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family G2-like
Protein Properties Length: 384aa    MW: 42271.9 Da    PI: 7.2251
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.007G102900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.52.6e-32210265156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W+++LH+rF++a++qLGG++ AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Phvul.007G102900.1 210 KQRRCWSQDLHKRFLHALQQLGGADSATPKQIRELMNVDGLTNDEVKSHLQKYRLH 265
                         79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.598207267IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-29208268IPR009057Homeodomain-like
SuperFamilySSF466894.75E-18208268IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-27210265IPR006447Myb domain, plants
PfamPF002492.4E-7212263IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MYFFTEKIQR LKMGFPDYIQ ALEEERRKIQ VFCKELPLSL ELVTQAIEAC KQQLSGTTSE  60
YNLNGQSECS ERTTSTEGPV LEEFIPIKKR ASSSPCCDED DEDNEQHSLK QSVLNENNDS  120
DKRKSDWLRS VQLWNPDPPA EEDATRKVPG MELKRSGSIG GAFHPFHKEE RAAKAAESLC  180
KAPSSTRVAA ASSSAGELTP EKNLNEGQRK QRRCWSQDLH KRFLHALQQL GGADSATPKQ  240
IRELMNVDGL TNDEVKSHLQ KYRLHTRRPS PLVHNSSSPQ AAPFVLVGNI FVQSPEYAAV  300
ATSTASREVI TVAAPGGVYA PVATHPTPVS QPSADSIKKP QFKKSKHSEH SNSDERAHHS  360
EGAVHSNSPT SSSSTHTSTS PGY*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phosphate signaling in roots. {ECO:0000250|UniProtKB:Q9FX67}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.007G102900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311960.0KT031196.1 Glycine max clone HN_CCL_161 MYB/HD-like transcription factor (Glyma10g34780.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007143802.10.0hypothetical protein PHAVU_007G102900g
SwissprotQ9FPE83e-90HHO3_ARATH; Transcription factor HHO3
TrEMBLV7BH500.0V7BH50_PHAVU; Uncharacterized protein
STRINGXP_007143802.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39183363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.14e-86G2-like family protein
Publications ? help Back to Top
  1. Nagarajan VK,Satheesh V,Poling MD,Raghothama KG,Jain A
    Arabidopsis MYB-Related HHO2 Exerts a Regulatory Influence on a Subset of Root Traits and Genes Governing Phosphate Homeostasis.
    Plant Cell Physiol., 2016. 57(6): p. 1142-52
    [PMID:27016098]