PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.007G071900.1
Common NamePHAVU_007G071900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family Nin-like
Protein Properties Length: 992aa    MW: 109857 Da    PI: 5.6839
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.007G071900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.51.3e-28584634252
              RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         ek+isle+l++yF++++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  Phvul.007G071900.1 584 EKSISLEVLQRYFAGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 634
                         799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.53573654IPR003035RWP-RK domain
PfamPF020421.8E-25587634IPR003035RWP-RK domain
SuperFamilySSF542771.21E-23892981No hitNo description
SMARTSM006661.2E-26896978IPR000270PB1 domain
PROSITE profilePS5174525.037896978IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2402.4E-27896977No hitNo description
PfamPF005647.2E-19896977IPR000270PB1 domain
CDDcd064076.93E-38897977No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0010118Biological Processstomatal movement
GO:0010167Biological Processresponse to nitrate
GO:0042128Biological Processnitrate assimilation
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 992 aa     Download sequence    Send to blast
MSESEEENTD YVTRSKPAEE AGCTMDFDLD LETSWPLDHM AFVSNPMSPF LFSSSTSDQP  60
YSPLWAFSDG EDLKLPASAF SDCHKIFPCD SNSIAEKPEE NDDNKKPLPP LAPMPPVENV  120
GGYCVIKERM TQALRYFKEL TELNVLAQVW APVRNGNRYV LTTSGQPFVL DPHSNGLHQY  180
RTVSLMYMFD VDGENDGSLG LPGRVFQQKL PEWTPNVLYY SSKEYPRRDH AQHYNVRGSL  240
ALPVFEPALQ SCVGVLELIM TSQKINYAPE VDKICKALET VNLRSSEILD HPYTQICNEG  300
RQNALSEILE ILTVVCETHN LPLAQTWIPC KHRIVLAQGG GVKKSCSSFD GSCMGKVCMS  360
TTDIAFYIID AHLWGFREAC LEHHLQQSQG VAGRAFLSQS MCFCSNITQF CKTDYPLVHY  420
ALMFGLTSCF AICLRSSHTG TDDYVLEFFL PPRVTDFHEQ KALLASILAT MKQHFQSLKV  480
ASGVELEDGS IEIIEATIER IHTRHESIPI APSFRSPPRP DTSPNMEEEV PRDPSEQQHI  540
LMYCNGTNHG ANLRDKAGGN IDHMTTLETK NSKKPLERKR GKTEKSISLE VLQRYFAGSL  600
KDAAKSLGVC PTTMKRICRQ HGISRWPSRK INKVNRSLSK LKRVIESVQG AEGAFGLNSL  660
STSPLPIAVG SLPEPSTPNK FSQQVSMGIR PSEPQMKVNE LNASKELETN RQAGMEDQLI  720
GGRIRNFERV SNDKGGSTQE VGREPKRTRT GSGSSEDSTN PTSHSSWHDS PPNESSPVKD  780
IFITSNHDQC AVLRRSSPGS TLQPATDTPN HPTSYPMPEF VSAELQEPFG GMLLEDAGSS  840
KDLRNLCPSV AEAILEDLVP EACGTNPPAL DLSPKQSMGT PNKVVTPFAA TKEMKTVTIK  900
ATYREDIIRF RVSLACGIVE LKEEVAKRLK LEVGTFDIKY LDDDHEWVLI ACDADLQECM  960
DVSRSSGSNI IRVLVHDITS NLGSSCESSG E*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in regulation of nitrate assimilation and in transduction of the nitrate signal. {ECO:0000269|PubMed:18826430}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00449DAPTransfer from AT4G24020Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.007G071900.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not regulated by the N source or by nitrate. {ECO:0000269|PubMed:18826430}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007143431.10.0hypothetical protein PHAVU_007G071900g
SwissprotQ84TH90.0NLP7_ARATH; Protein NLP7
TrEMBLV7BCW80.0V7BCW8_PHAVU; Uncharacterized protein
STRINGXP_007143431.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42573456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7
Publications ? help Back to Top
  1. Xu N, et al.
    The Arabidopsis NRG2 Protein Mediates Nitrate Signaling and Interacts with and Regulates Key Nitrate Regulators.
    Plant Cell, 2016. 28(2): p. 485-504
    [PMID:26744214]
  2. Karve R,Suárez-Román F,Iyer-Pascuzzi AS
    The Transcription Factor NIN-LIKE PROTEIN7 Controls Border-Like Cell Release.
    Plant Physiol., 2016. 171(3): p. 2101-11
    [PMID:27221617]
  3. Yu LH, et al.
    Overexpression of Arabidopsis NLP7 improves plant growth under both nitrogen-limiting and -sufficient conditions by enhancing nitrogen and carbon assimilation.
    Sci Rep, 2016. 6: p. 27795
    [PMID:27293103]
  4. Menz J,Li Z,Schulze WX,Ludewig U
    Early nitrogen-deprivation responses in Arabidopsis roots reveal distinct differences on transcriptome and (phospho-) proteome levels between nitrate and ammonium nutrition.
    Plant J., 2016. 88(5): p. 717-734
    [PMID:27419465]
  5. Yan D, et al.
    NIN-like protein 8 is a master regulator of nitrate-promoted seed germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 13179
    [PMID:27731416]
  6. Guan P, et al.
    Interacting TCP and NLP transcription factors control plant responses to nitrate availability.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(9): p. 2419-2424
    [PMID:28202720]
  7. Liu KH, et al.
    Discovery of nitrate-CPK-NLP signalling in central nutrient-growth networks.
    Nature, 2017. 545(7654): p. 311-316
    [PMID:28489820]
  8. Li Z, et al.
    The Arabidopsis CPSF30-L gene plays an essential role in nitrate signaling and regulates the nitrate transceptor gene NRT1.1.
    New Phytol., 2017. 216(4): p. 1205-1222
    [PMID:28850721]
  9. Cao H, et al.
    Overexpression of the Maize ZmNLP6 and ZmNLP8 Can Complement the Arabidopsis Nitrate Regulatory Mutant nlp7 by Restoring Nitrate Signaling and Assimilation.
    Front Plant Sci, 2017. 8: p. 1703
    [PMID:29051766]
  10. Konishi N,Okubo T,Yamaya T,Hayakawa T,Minamisawa K
    Nitrate Supply-Dependent Shifts in Communities of Root-Associated Bacteria in Arabidopsis.
    Microbes Environ., 2017. 32(4): p. 314-323
    [PMID:29187692]
  11. Karve RA,Iyer-Pascuzzi AS
    Further insights into the role of NIN-LIKE PROTEIN 7 (NLP7) in root cap cell release.
    Plant Signal Behav, 2018. 13(1): p. e1414122
    [PMID:29215953]
  12. Zhao L, et al.
    The Arabidopsis NLP7 gene regulates nitrate signaling via NRT1.1-dependent pathway in the presence of ammonium.
    Sci Rep, 2018. 8(1): p. 1487
    [PMID:29367694]