PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.007G067500.1
Common NamePHAVU_007G067500g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family HD-ZIP
Protein Properties Length: 767aa    MW: 84134.8 Da    PI: 6.0534
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.007G067500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.31.9e-2168123156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t++q++eLe++F+++++p++++r +L+k+lgL+ +qVk+WFqNrR+++k
  Phvul.007G067500.1  68 KKRYHRHTPHQIQELESFFKECPHPDEKQRLDLSKRLGLENKQVKFWFQNRRTQMK 123
                         688999***********************************************999 PP

2START180.21.1e-562785012206
                         HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
               START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                         la++a++el+k+ +ae+p+W ks     e  n +e+ + f++  +     + +ea r++g+v+ ++  lve+l+d + +W e+++    +a
  Phvul.007G067500.1 278 LALAAMEELLKMTQAESPLWIKSLdgekEVFNHEEYARLFSPCIGpkptgYVTEATRETGIVIINSLALVETLMDAN-RWAEMFPsmiaRA 367
                         6899********************876666688999999999888********************************.*******999999 PP

                         EEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEE CS
               START  80 etlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghsk 163
                           l+vis+g      galq+m ae q+lsplvp R + f+R+++q+ +g+w++vdvS+d   +  + ++++ +++lpSg+++++++ng+sk
  Phvul.007G067500.1 368 INLDVISNGmggtrnGALQVMHAEVQLLSPLVPvRQVRFIRFCKQHAEGVWAVVDVSIDIVHDSANAQPFMSCRRLPSGCIVQDMPNGYSK 458
                         99**********************************************************999999************************* PP

                         EEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 164 vtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         vtw+eh++++++++h+l+r+l++sg+ +ga +w atlqrqce+
  Phvul.007G067500.1 459 VTWLEHWEYDESVVHQLYRPLLSSGVGFGAHRWIATLQRQCEC 501
                         *****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.59E-2052125IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.5E-2254119IPR009057Homeodomain-like
PROSITE profilePS5007117.68665125IPR001356Homeobox domain
SMARTSM003892.3E-1966129IPR001356Homeobox domain
CDDcd000863.35E-1967125No hitNo description
PfamPF000464.2E-1968123IPR001356Homeobox domain
PROSITE patternPS000270100123IPR017970Homeobox, conserved site
PROSITE profilePS5084841.364268504IPR002913START domain
SuperFamilySSF559611.47E-31270501No hitNo description
CDDcd088752.93E-119272500No hitNo description
SMARTSM002344.6E-37277501IPR002913START domain
PfamPF018525.6E-47278501IPR002913START domain
SuperFamilySSF559613.09E-21529760No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 767 aa     Download sequence    Send to blast
MQNSSSFSYS NQRKMEGPSE IGLIGENFDA GLMGRMRDDE YESRSGSDNF DGVSGDDQDG  60
GDDQPQRKKR YHRHTPHQIQ ELESFFKECP HPDEKQRLDL SKRLGLENKQ VKFWFQNRRT  120
QMKTQLERHE NIMLRQENDK LRAENSLMKE AMSNPVCNSC GGPAIPGQIS FEEHQIRIEN  180
ARLKDELNRI CALANKFLGK PISSMTSPMA LPNSNSGLEL GIGRNGLGGS STLGTPLPMG  240
LDLGDGVLGT QTAMPGIRPS LGLMGNEVQL ERSMLIDLAL AAMEELLKMT QAESPLWIKS  300
LDGEKEVFNH EEYARLFSPC IGPKPTGYVT EATRETGIVI INSLALVETL MDANRWAEMF  360
PSMIARAINL DVISNGMGGT RNGALQVMHA EVQLLSPLVP VRQVRFIRFC KQHAEGVWAV  420
VDVSIDIVHD SANAQPFMSC RRLPSGCIVQ DMPNGYSKVT WLEHWEYDES VVHQLYRPLL  480
SSGVGFGAHR WIATLQRQCE CLAILMSSSI SSDDHTALSQ AGRRSMLKLA QRMTGNFCSG  540
VCASSARKWD MLHIGTLGDD MKVMTRKNVD DPGEPPGIVL SAATSVWMPV SRQRVFDFLR  600
DERLRSEWDI LSNGGPMQEM VHIAKGQGHG NCVSLLRANA VNANDSSMLI LQETWMDASC  660
SVVVYAPVDV QSLNVVMSGG DSAYVALLPS GFAILPDGHC NNNSSCNGTM QKGGGGEESG  720
GSLLTVGFQI LVNSLPTAKL TVESVDTVNN LISCTIQKIK GALRVA*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.007G067500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007143378.10.0hypothetical protein PHAVU_007G067500g
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLV7BBY40.0V7BBY4_PHAVU; Uncharacterized protein
STRINGXP_007143378.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]