PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.007G019900.1
Common NamePHAVU_007G019900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family G2-like
Protein Properties Length: 312aa    MW: 34359.4 Da    PI: 6.7216
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.007G019900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.94.9e-331972255
             G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        prlrWtpeLH++Fv+a+e+LGG++kAtPk +l+lm+vkgLt++hvkSHLQ+YR+
  Phvul.007G019900.1 19 PRLRWTPELHRCFVHAIESLGGHQKATPKLVLQLMDVKGLTISHVKSHLQMYRS 72
                        8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.4E-321574IPR009057Homeodomain-like
PROSITE profilePS5129410.931575IPR017930Myb domain
SuperFamilySSF466891.11E-151772IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-231972IPR006447Myb domain, plants
PfamPF002492.9E-82071IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MGSCGREGAV RQYIRSKVPR LRWTPELHRC FVHAIESLGG HQKATPKLVL QLMDVKGLTI  60
SHVKSHLQMY RSMRGDLGRQ GRTPSQHRNQ SFEEHDDGCV DEVNDVGVEY SCSKPMGRES  120
DSFFGHSNLP PKRARIETRS SISESLQCSL RLCDAVPNPY CFYDYLQNPM AEHKGIKEFC  180
KASTWQIQPH SSLLPHFPNL TSFQSPNQNS DFLQVTTLNE GKSSGKGINV DVNTETGEAE  240
VEDVGGYELS LSLTMANPSP QRSNGSCSGS EISETISSYP AAGFSNYKDC TSSSTLKETI  300
NLDLSLALCG N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-202074458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-202074458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-202074357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-202074357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-202074357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-202074357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-202074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-202074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-202074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-202074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-202074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-202074458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.007G019900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0982250.0BT098225.1 Soybean clone JCVI-FLGm-16F9 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007142823.10.0hypothetical protein PHAVU_007G019900g
TrEMBLV7BAB20.0V7BAB2_PHAVU; Uncharacterized protein
STRINGXP_007142823.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF55393353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.19e-35G2-like family protein