PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.006G134800.1
Common NamePHAVU_006G134800g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family G2-like
Protein Properties Length: 314aa    MW: 34227.9 Da    PI: 7.3757
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.006G134800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1062.1e-334296155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprlrWt++LHerFv+av+qLGG+ kAtPk+i+++m+vkgLtl h+kSHLQkYRl
  Phvul.006G134800.1 42 KPRLRWTQDLHERFVDAVTQLGGASKATPKAIMRTMNVKGLTLFHLKSHLQKYRL 96
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.5693999IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.5E-323997IPR009057Homeodomain-like
SuperFamilySSF466891.27E-164298IPR009057Homeodomain-like
TIGRFAMsTIGR015577.7E-244297IPR006447Myb domain, plants
PfamPF002492.0E-74495IPR001005SANT/Myb domain
PfamPF143792.2E-15137182IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MYPRLIHPHD GIVAQDDMQA AASNLSHSHK GDPCLVLTAD PKPRLRWTQD LHERFVDAVT  60
QLGGASKATP KAIMRTMNVK GLTLFHLKSH LQKYRLGKQS GKDLGEGCKD GSYLLESPGT  120
ENTSPKLPTS DTNEGYEIKE ALRAQMEVQS KLHLQVEAEK HLQIRQDAER RYMAMLERAC  180
KMLADQFIGA TVIDTDSQKF QAIGSKTPRG TLVDPLGFYS LPSAEVAGVN VPDEEIPHSL  240
PPQRADCSTE SCLTSHESSG GLTLEGSPGG GKRRMLGMDS MAAPLIWSEA KMRTQAINVA  300
QGSHPQGITR YGM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-184298258Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-184298258Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-184298157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-184298157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-184298157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-184298157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-184298258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-184298258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-184298258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-184298258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-184298258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-184298258Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.006G134800.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0936500.0BT093650.1 Soybean clone JCVI-FLGm-24E4 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007147561.10.0hypothetical protein PHAVU_006G134800g
SwissprotQ94A571e-63PHL2_ARATH; Protein PHR1-LIKE 2
TrEMBLV7BR790.0V7BR79_PHAVU; Uncharacterized protein
STRINGXP_007147561.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66183349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.13e-65G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]