PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.006G114700.1
Common NamePHAVU_006G114700g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family LBD
Protein Properties Length: 172aa    MW: 19326.1 Da    PI: 5.0512
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.006G114700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260126.41.3e-3916114199
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaC++lrr+C ++Cvlapyfp ++ ++fa+vh++FGasnv+++++ ++e++reda++s+vyeA ar+rdPvyG++g i +lq+ +e++k
  Phvul.006G114700.1  16 PCAACRMLRRRCDSKCVLAPYFPTNEVENFAVVHRVFGASNVVRMIQMVEETKREDAVKSMVYEATARLRDPVYGSAGSIYELQKMIEEVK 106
                         7****************************************************************************************** PP

              DUF260  92 aelallke 99 
                         a+l+++k+
  Phvul.006G114700.1 107 AQLDSIKT 114
                         **998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.41615116IPR004883Lateral organ boundaries, LOB
PfamPF031958.7E-4016113IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MGFRADEAKP SMQHQPCAAC RMLRRRCDSK CVLAPYFPTN EVENFAVVHR VFGASNVVRM  60
IQMVEETKRE DAVKSMVYEA TARLRDPVYG SAGSIYELQK MIEEVKAQLD SIKTRVSEMQ  120
EQKEQLLSIS GNYNPLFGVN DPMFDSPMAS DPFEFPLEGG WVYTNIPAPS C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-331611611111LOB family transfactor Ramosa2.1
5ly0_B4e-331611611111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.006G114700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150382e-70AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007147329.11e-127hypothetical protein PHAVU_006G114700g
SwissprotQ9SK081e-42LBD11_ARATH; LOB domain-containing protein 11
TrEMBLV7BQN11e-125V7BQN1_PHAVU; Uncharacterized protein
STRINGXP_007147329.11e-126(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF140681921
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.16e-45LOB domain-containing protein 11