PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.006G104700.1
Common NamePHAVU_006G104700g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family G2-like
Protein Properties Length: 404aa    MW: 44831.7 Da    PI: 4.6925
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.006G104700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.47.5e-34193247155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+r+rWtpeLHe+Fveav+qLGGse+AtPk +l++mkv+gLt++hvkSHLQkYR+
  Phvul.006G104700.1 193 KTRMRWTPELHEAFVEAVNQLGGSERATPKGVLNVMKVDGLTIYHVKSHLQKYRT 247
                         68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.234190250IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-31191249IPR009057Homeodomain-like
SuperFamilySSF466891.04E-17191247IPR009057Homeodomain-like
TIGRFAMsTIGR015579.2E-25193247IPR006447Myb domain, plants
PfamPF002491.6E-9195246IPR001005SANT/Myb domain
PfamPF143795.7E-21280324IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MSSSSRVLPT PLENKYMKPP DSCHLSPASD LAANSVSSNS VRSAANPDGT LFSYASQHDK  60
QYEDPPFVPQ TLGDNVSSEI HSTTFISHPH ENEDITWGPD PFQDIIGFPE NISAQHDQVV  120
ENGCYINDDN VKRTDFGEWV DQLMSIDDSL HPNWSQLLGD DNVAEPKPKV PQLLDIPSGE  180
VVGNSAATTP QTKTRMRWTP ELHEAFVEAV NQLGGSERAT PKGVLNVMKV DGLTIYHVKS  240
HLQKYRTARY KPEPSEGTSE KKATPIEEMK SLDLKTSKGI TEALRLQMEL QKRLHEQLEI  300
QRKLQIQIED QGKRLQMMFE KQREMGDKKV NGSSDEAATA TPAAPSDSVL PSSPPVETSN  360
EGREKSMEEE KEESTKQKAR EGEEVINEDE DEVAPATKRV KSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-31193251260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-31193251260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-31193251260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-31193251260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-31193251260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-31193251260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-31193251260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-31193251260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as central integrator of phosphate starvation responses (PubMed:20838596). Regulates FER1 expression upon phosphate starvation, linking iron and phosphate homeostasis (PubMed:23788639). {ECO:0000269|PubMed:20838596, ECO:0000269|PubMed:23788639}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00532DAPTransfer from AT5G29000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.006G104700.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not up-regulated by Pi starvation. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN2015270.0JN201527.1 Glycine max PHR2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007147208.10.0hypothetical protein PHAVU_006G104700g
SwissprotQ8GUN51e-93PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLV7BMN30.0V7BMN3_PHAVU; Uncharacterized protein
STRINGXP_007147208.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15123498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.24e-88G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Bonnot C, et al.
    A chemical genetic strategy identify the PHOSTIN, a synthetic molecule that triggers phosphate starvation responses in Arabidopsis thaliana.
    New Phytol., 2016. 209(1): p. 161-76
    [PMID:26243630]
  4. Aleksza D,Horváth GV,Sándor G,Szabados L
    Proline Accumulation Is Regulated by Transcription Factors Associated with Phosphate Starvation.
    Plant Physiol., 2017. 175(1): p. 555-567
    [PMID:28765275]