PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.006G099400.1
Common NamePHAVU_006G0994001g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family GeBP
Protein Properties Length: 320aa    MW: 35102.1 Da    PI: 8.3162
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.006G099400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573124.16.7e-3915110297
              DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifels 92 
                         lfqrlw++eDei lLqG++d+++++g+s ++d+  fy+++k++++++++k+qlveKirrLKkK+++ v+k+ sgke+sf+++hdq +fe+s
  Phvul.006G099400.1  15 LFQRLWTDEDEIELLQGFLDYTSQRGSSHHNDTALFYDQIKSKLQLDFNKNQLVEKIRRLKKKYRNVVNKIGSGKEFSFKSAHDQATFEIS 105
                         79***************************************************************************************** PP

              DUF573  93 kkiWg 97 
                         +kiW 
  Phvul.006G099400.1 106 RKIWT 110
                         ****7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.3E-3516109IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MNEINQQPLD DSRRLFQRLW TDEDEIELLQ GFLDYTSQRG SSHHNDTALF YDQIKSKLQL  60
DFNKNQLVEK IRRLKKKYRN VVNKIGSGKE FSFKSAHDQA TFEISRKIWT SVAPIGENSL  120
DDDEINPCAN PNPSPHPNLN FSPVIHKNET ISRNSAEKKT PKRSRPRSAV KVESIDGSAS  180
NRDHNCTSNA TATGTPTATA TNTTAAAATA TTINNCNSGY SKNIPSLIEE TVRSCLSPVL  240
RELMGAMGGG AFGGRGSLNL NPLASMNLSY GGGELVDEKW RKQQILELEV YSKRLELVQD  300
QIKATMEELR SSGGGGGGG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150380.0AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007147143.10.0hypothetical protein PHAVU_006G0994001g, partial
TrEMBLV7BMG20.0V7BMG2_PHAVU; Uncharacterized protein (Fragment)
STRINGGLYMA03G40520.11e-165(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32553365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28040.12e-82DNA-binding storekeeper protein-related transcriptional regulator