PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.005G158800.1
Common NamePHAVU_005G158800g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family LBD
Protein Properties Length: 173aa    MW: 20108.2 Da    PI: 10.3207
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.005G158800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260119.42.1e-3710108199
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         aCaaCk++rrkC ++C+lap fp++++k+f  +h+lFG+ ++++++k l++ +r++am++++ye+++ra+dPv G++++i++lq+q++ ++
  Phvul.005G158800.1  10 ACAACKYQRRKCGSKCILAPFFPHHREKQFLLAHRLFGVGKITNMIKPLDPGRRNIAMATIIYESDMRAKDPVGGCLRIIQNLQSQIAYSQ 100
                         7****************************************************************************************** PP

              DUF260  92 aelallke 99 
                         +el+l+ +
  Phvul.005G158800.1 101 TELQLMLQ 108
                         **998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.5099110IPR004883Lateral organ boundaries, LOB
PfamPF031958.1E-3510105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MNDSRSSTQA CAACKYQRRK CGSKCILAPF FPHHREKQFL LAHRLFGVGK ITNMIKPLDP  60
GRRNIAMATI IYESDMRAKD PVGGCLRIIQ NLQSQIAYSQ TELQLMLQHL AFFRRSSPPP  120
SFSSHPSPLP FQFQHQFKSR GPLQIQEEKD PYHLLQEDIK LETDNQDAWR RRR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-211110312104LOB family transfactor Ramosa2.1
5ly0_B1e-211110312104LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.005G158800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007150515.11e-127hypothetical protein PHAVU_005G158800g, partial
SwissprotQ9LRW13e-41LBD22_ARATH; LOB domain-containing protein 22
TrEMBLV7BX411e-126V7BX41_PHAVU; Uncharacterized protein (Fragment)
STRINGXP_007150515.11e-127(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41333259
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.16e-42LOB domain-containing protein 22
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]