PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.005G155100.1
Common NamePHAVU_005G155100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family Nin-like
Protein Properties Length: 979aa    MW: 107671 Da    PI: 6.5037
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.005G155100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.65.8e-29600650252
              RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         ek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  Phvul.005G155100.1 600 EKSVSLSVLQQYFSGSLKDAAKNIGVCPTTLKRICRQHGISRWPSRKINKV 650
                         899**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.063584670IPR003035RWP-RK domain
PfamPF020427.0E-26603650IPR003035RWP-RK domain
SuperFamilySSF542778.13E-20873960No hitNo description
SMARTSM006667.9E-19878960IPR000270PB1 domain
PROSITE profilePS5174518.689878958IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2403.7E-21879959No hitNo description
PfamPF005643.8E-15881959IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 979 aa     Download sequence    Send to blast
MEYPFSSKGR EIGDWQSSGT QLVGSTSLDA RMSNSISEDM SNSFSELMSF DTYAGLCNSP  60
SISDQILANE LPSFASLSYS LPDGFNIVQQ NNGQCYMSEV GRNNNDMESS PIYGEKVACQ  120
QMDTLLGFLS DANEANNLNS KLKVNGSPQH LNNSVAGNYI MSRPPALSLD ERMLRALSFF  180
KESAGGGILA QVWVPIKDGD QLILSTSEQP YLLDQMLAGY REVSRTFTFS AEGKSDCFLG  240
LPGRVFTSKV HEWTSNVGYY SMNEYLRFEH AVNHHVRGSI AFPIFDVHSE LSCCAVLEIV  300
TTKEKPDFSR EFEIVCRALQ LVNLRTVKPL RCLPQCLSNN KKATLTEIVD VLRSVCHAHR  360
LPLALTWLPC CYTEGSRGEA TRIIKGGHST NSGKSILCIE ESACYITDRA LEGFVRACTE  420
HPLEEGKGIA GKALRSNHPF FCPDVKTYDV SEYPLVHHAR KYNLNAAVAI RLRSTYTNND  480
DYILEFFLPV NMKGGSEQQL LLDNLSGTMQ RICSSLRTVS DIELSRIESS QEGFGKKNAP  540
CFSPLSSRNS EVPLENGDCH SVPMMSLKAT NARDNEIEPS THQGRNGTKR QVQKNRSTSE  600
KSVSLSVLQQ YFSGSLKDAA KNIGVCPTTL KRICRQHGIS RWPSRKINKV NRSLKKIQTV  660
LDSVQGVEGG LKFDPSMGAF VAGGSTIQET DAHKSLLFPE KSIVKDATPI TQKSVSVPPA  720
PCSEVENFAF KLDEKLKKTN AFSVGCSEDS KSMAIDDGSC KMERLCIKVQ DCPEQACLGS  780
VFPKEQDKWI LNKSGLGVEN FKSSIRGQSS NSLFGNQMHI GVDGDAGVIE PNHPSSSSLT  840
DSSNGSGSMM HSISSGSQSF KNQNQSNVKS TIVDSGSKLI VKAIYREDTI RFKFDRSAGC  900
FSLYEEVAAR FKLQTGSFQL KYLDDEEEWV MLVNDADLQE CLEILDDIGT CNVRFLVRDL  960
PLILSSSGSS NCYLGGSS*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.005G155100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007150469.10.0hypothetical protein PHAVU_005G155100g
RefseqXP_007150470.10.0hypothetical protein PHAVU_005G155100g
RefseqXP_007150471.10.0hypothetical protein PHAVU_005G155100g
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLV7BZI50.0V7BZI5_PHAVU; Uncharacterized protein
STRINGXP_007150469.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34643465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein
Publications ? help Back to Top
  1. Yan D, et al.
    NIN-like protein 8 is a master regulator of nitrate-promoted seed germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 13179
    [PMID:27731416]