PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.005G142900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family WOX
Protein Properties Length: 224aa    MW: 25111.5 Da    PI: 9.1566
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.005G142900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.42.8e-191877357
                        --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                        +R++++keq+ +Le+++++  r+p++e+++e++++l    +++ ++V++WFqN++a++++
  Phvul.005G142900.1 18 SRWSPKKEQIAILESFYKQgIRTPNTEQIKEITSRLsaygHIQGKNVFYWFQNHKARQRQ 77
                        6*****************99**************************************97 PP

2Wus_type_Homeobox111.83.6e-361779365
   Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                         +RW+P++eQi iLe+ yk+G+rtPn+e+i++it++L++yG+i++kNVfyWFQN+kaR+rqkq
  Phvul.005G142900.1 17 VSRWSPKKEQIAILESFYKQGIRTPNTEQIKEITSRLSAYGHIQGKNVFYWFQNHKARQRQKQ 79
                        58***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.3821378IPR001356Homeobox domain
SMARTSM003892.8E-41582IPR001356Homeobox domain
SuperFamilySSF466891.54E-121785IPR009057Homeodomain-like
PfamPF000464.8E-171877IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.7E-81884IPR009057Homeodomain-like
CDDcd000862.14E-51973No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MESRTSAGRE PSGSLSVSRW SPKKEQIAIL ESFYKQGIRT PNTEQIKEIT SRLSAYGHIQ  60
GKNVFYWFQN HKARQRQKQK QQCIAYSNSF LHASQPIGQT VVCAPFYPQQ CGMNFYPQPG  120
KIVPAGGVIE TVVPFGMLKM CDVQQKQLQQ RVQTGYNYSI SDSKTLTLFP LHPTGILEEK  180
TTNQVSSHAS LVSVDVTDTC HGSLSVVEDS RPEKQQFLDF LTF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.005G142900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017423722.11e-103PREDICTED: WUSCHEL-related homeobox 2-like
TrEMBLA0A0L9UN031e-101A0A0L9UN03_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SGD41e-101A0A0S3SGD4_PHAAN; Uncharacterized protein
STRINGGLYMA13G41000.16e-68(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.16e-35WUSCHEL related homeobox 2