PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.005G137300.1
Common NamePHAVU_005G137300g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family LBD
Protein Properties Length: 200aa    MW: 21895.7 Da    PI: 5.1902
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.005G137300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.22.4e-42341331100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+Ca++Cvlapyfp ++p+kf  +h++FGasn++k+l++lpe++r da++s+vyeA ar+rdPvyG++g i +lq+q+++l+
  Phvul.005G137300.1  34 PCAACKILRRRCADKCVLAPYFPPTEPAKFTTAHRVFGASNIIKFLQELPESQRADAVASMVYEAGARIRDPVYGCAGAICQLQKQVNELQ 124
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         a+la++++e
  Phvul.005G137300.1 125 AQLAKAQAE 133
                         *****9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.91733134IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-4234131IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MESDTNTTLT SSPTFSHSSN TLSSSSPPQL VMTPCAACKI LRRRCADKCV LAPYFPPTEP  60
AKFTTAHRVF GASNIIKFLQ ELPESQRADA VASMVYEAGA RIRDPVYGCA GAICQLQKQV  120
NELQAQLAKA QAEVVTMQLQ QANLVALICM EMSQTPQESP QQSPDNFITS PSHNSGYQNN  180
LSFFEDNTNL NSMWEPLWT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-423416011127LOB family transfactor Ramosa2.1
5ly0_B4e-423416011127LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.005G137300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150401e-137AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007150227.11e-147hypothetical protein PHAVU_005G137300g
SwissprotQ9SK081e-78LBD11_ARATH; LOB domain-containing protein 11
TrEMBLV7C0151e-146V7C015_PHAVU; Uncharacterized protein
STRINGXP_007150227.11e-147(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.15e-70LOB domain-containing protein 11