PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.005G123900.1
Common NamePHAVU_005G123900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family G2-like
Protein Properties Length: 431aa    MW: 48638.8 Da    PI: 8.6274
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.005G123900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.92.3e-3346100155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kprl+Wtp+LH+rF+eav+qLGG++kAtPkt+++lm++ gLtl+h+kSHLQkYRl
  Phvul.005G123900.1  46 KPRLKWTPDLHARFIEAVNQLGGADKATPKTVMKLMGISGLTLYHLKSHLQKYRL 100
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.1643103IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.6E-3144101IPR009057Homeodomain-like
SuperFamilySSF466894.66E-1645101IPR009057Homeodomain-like
TIGRFAMsTIGR015575.0E-2346101IPR006447Myb domain, plants
PfamPF002492.5E-94899IPR001005SANT/Myb domain
PfamPF143796.4E-24157202IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    Send to blast
MYHHHRHQGK NIHSTSRMPI PSERHMFLQT GNGSGDSGLV LSTDAKPRLK WTPDLHARFI  60
EAVNQLGGAD KATPKTVMKL MGISGLTLYH LKSHLQKYRL SKNLHGQSNN VTHKMTTSAT  120
TGERLSETSG THMSKLSLGP QANNHANFQC LLSKDLHIGE ALQMQIEVQR RLNEQLEVQK  180
HLQLRIEAQG KYLQSVLEKA QDTLGRQNLG IIGLETAKVQ LSELVSKVSS QCLNSAFSEL  240
KELQGFCPQQ THTNQPNDCS MDSCLTSCDI LQKEQKIQNS LRQFNSHVFM EQKESTDARN  300
NLRNSELKWC DDGKKNTFLA PLSKTEERRK YAAETGPGNL SMSIGLERET ENRSSMYPES  360
LIKESQSEGE FQHRNRIKTE TMKAVDEKVC QDYRMPASYF VATRLDLNNH GDNEAATTCK  420
QLDLNRFSWS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A7e-2045102158Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B7e-2045102158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A7e-2046102157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B7e-2046102157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C7e-2046102157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D7e-2046102157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A7e-2045102158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C7e-2045102158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D7e-2045102158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F7e-2045102158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H7e-2045102158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J7e-2045102158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that may activate the transcription of specific genes involved in nitrogen uptake or assimilation (PubMed:15592750). Acts redundantly with MYR1 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269|PubMed:21255164, ECO:0000305|PubMed:15592750}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00331DAPTransfer from AT3G04030Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.005G123900.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by nitrogen deficiency. {ECO:0000269|PubMed:15592750}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007150070.10.0hypothetical protein PHAVU_005G123900g
SwissprotQ9SQQ91e-138PHL9_ARATH; Myb-related protein 2
TrEMBLV7BVR80.0V7BVR8_PHAVU; Uncharacterized protein
STRINGXP_007150070.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38523163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-141G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Nakano Y,Naito Y,Nakano T,Ohtsuki N,Suzuki K
    NSR1/MYR2 is a negative regulator of ASN1 expression and its possible involvement in regulation of nitrogen reutilization in Arabidopsis.
    Plant Sci., 2017. 263: p. 219-225
    [PMID:28818378]