PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.005G100700.1
Common NamePHAVU_005G100700g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family G2-like
Protein Properties Length: 436aa    MW: 48079 Da    PI: 6.2912
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.005G100700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.71.1e-27165219156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k +++WtpeLH+rFv+aveqL G +kA+P++ile+m++++Lt+++++SHLQkYR++
  Phvul.005G100700.1 165 KVKVDWTPELHRRFVQAVEQL-GVDKAVPSRILEIMGIDCLTRHNIASHLQKYRSH 219
                         5689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.042162221IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-26163222IPR009057Homeodomain-like
SuperFamilySSF466894.84E-18163222IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-26165219IPR006447Myb domain, plants
PfamPF002491.4E-7168217IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    Send to blast
MLAVSPLRSR SDEEQGEMES FSIGTDDFAD LSEGNLLESI NFDDLFMGIN DDEDVLPDLE  60
MDPELLAEFS LSEESEIVSS VSVANNKSDD RNENNIVITE TQDEVIAANF CSDSGSNSGS  120
SRGEETGNKS DESTHSVGVN PSPKESEKGR KSSSHSRNNQ QGKRKVKVDW TPELHRRFVQ  180
AVEQLGVDKA VPSRILEIMG IDCLTRHNIA SHLQKYRSHR KHLIAREAEA ARWSQRKQFM  240
GAASVGRGGG KRDVNPWLAP TMGFPPMTPM HHFRPLHVWG HHTMDQSFIH MWPKHLPYSP  300
SRPAWPPRTA PSPPPPDPLY WHQHQRAPNA PTPGTPCFPQ PLTTTRFGSQ TVPGIPPHHA  360
MFQMVDPGIG LPATQPPPRP LLDFHPSKES IDAAISDVLS KPWLPLPLGL KAPALDGVMG  420
ELQRQGIPKI PPSCA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-15162217257ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that functions with GLK2 to promote chloroplast development. Acts as an activator of nuclear photosynthetic genes involved in chlorophyll biosynthesis, light harvesting, and electron transport. Acts in a cell-autonomous manner to coordinate and maintain the photosynthetic apparatus within individual cells. May function in photosynthetic capacity optimization by integrating responses to variable environmental and endogenous cues (PubMed:11828027, PubMed:12220263, PubMed:17533111, PubMed:18643989, PubMed:19376934, PubMed:19383092, PubMed:19726569). Prevents premature senescence (PubMed:23459204). {ECO:0000269|PubMed:11828027, ECO:0000269|PubMed:12220263, ECO:0000269|PubMed:17533111, ECO:0000269|PubMed:18643989, ECO:0000269|PubMed:19376934, ECO:0000269|PubMed:19383092, ECO:0000269|PubMed:19726569, ECO:0000269|PubMed:23459204}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.005G100700.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By light. Repressed by BZR2. {ECO:0000269|PubMed:12220263, ECO:0000269|PubMed:21214652}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007149809.10.0hypothetical protein PHAVU_005G100700g
SwissprotQ9SIV31e-91GLK1_ARATH; Transcription activator GLK1
TrEMBLV7BXL10.0V7BXL1_PHAVU; Uncharacterized protein
STRINGXP_007149809.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42423461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.14e-80GBF's pro-rich region-interacting factor 1
Publications ? help Back to Top
  1. Leister D,Kleine T
    Definition of a core module for the nuclear retrograde response to altered organellar gene expression identifies GLK overexpressors as gun mutants.
    Physiol Plant, 2016. 157(3): p. 297-309
    [PMID:26876646]
  2. Nagatoshi Y, et al.
    GOLDEN 2-LIKE transcription factors for chloroplast development affect ozone tolerance through the regulation of stomatal movement.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(15): p. 4218-23
    [PMID:27035938]
  3. Tokumaru M, et al.
    Ubiquitin-Proteasome Dependent Regulation of the GOLDEN2-LIKE 1 Transcription Factor in Response to Plastid Signals.
    Plant Physiol., 2017. 173(1): p. 524-535
    [PMID:27821720]
  4. Ni F, et al.
    Turnip Yellow Mosaic Virus P69 Interacts with and Suppresses GLK Transcription Factors to Cause Pale-Green Symptoms in Arabidopsis.
    Mol Plant, 2017. 10(5): p. 764-766
    [PMID:27964999]
  5. Wang H,Seo JK,Gao S,Cui X,Jin H
    Silencing of AtRAP, a target gene of a bacteria-induced small RNA, triggers antibacterial defense responses through activation of LSU2 and down-regulation of GLK1.
    New Phytol., 2017. 215(3): p. 1144-1155
    [PMID:28656601]