PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.005G094600.1
Common NamePHAVU_005G094600g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family G2-like
Protein Properties Length: 365aa    MW: 41289.8 Da    PI: 7.4055
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.005G094600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.31.3e-3187140255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         prlrWtp+LH +Fv+ave+LGG+e+AtPk +l+lm+v gL+++hvkSHLQ+YR+
  Phvul.005G094600.1  87 PRLRWTPDLHLAFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRS 140
                         8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.56283143IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.5E-3083141IPR009057Homeodomain-like
SuperFamilySSF466892.15E-1485141IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-2287142IPR006447Myb domain, plants
PfamPF002495.4E-988139IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MDERNCISEE DKSESSKTSS AILRRKRSFL DLNEEAADDG DGSTSDDPIS INDISSQEGN  60
LSSNNNSSEE GKERATAVRQ YVRSKMPRLR WTPDLHLAFV HAVERLGGQE RATPKLVLQL  120
MNVRGLSIAH VKSHLQMYRS KKLDESGQVL SQNKAMQGRH SIFDMYGRLN APRHFVVDNR  180
NYIPSSLLIQ QSPYQISAHG SSRSHPTGFF NGHMMIRSSS MWDKDLCSYQ YQRSSCSPNF  240
AGHAKFDAEV RDVKNRMPEF LNQVQVWKQG HVKDELERLN EKKGSPSFLE LNLSPDSRNI  300
NSDEQMKKDP AESEQEINTR LSLSLFTSSS SNSSQQAQCS ENHKDDTHVE SFCLQNYAPR  360
TRLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-1888142458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-1888142458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-1888142357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-1888142357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-1888142357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-1888142357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-1888142458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-1888142458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-1888142458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-1888142458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-1888142458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-1888142458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.005G094600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150401e-135AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007149732.10.0hypothetical protein PHAVU_005G094600g
TrEMBLV7BYQ00.0V7BYQ0_PHAVU; Uncharacterized protein
STRINGXP_007149732.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30123270
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.13e-38G2-like family protein