PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.005G087800.1
Common NamePHAVU_005G087800g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family NZZ/SPL
Protein Properties Length: 303aa    MW: 33168.7 Da    PI: 7.1019
Description NZZ/SPL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.005G087800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NOZZLE35.91.6e-111830042314
              NOZZLE  42 srgrkpgsktaqqkqkkptlrgmgvaklerfiieeekkklvvatvgdtssvaaisnta....trlpvpvdrgvvlqgfps......slgss 122
                          r r    +t  +  kkp  rg+gva+ler +i+e  kk+   + g     a           r p p + g  +q           +g++
  Phvul.005G087800.1  18 GRSRSRSRRTNGKGPKKPPQRGLGVAQLERLRIQESWKKMSEGSSGVLPVTALHDHHQqqlfQRHPSP-NLGFQFQCPQHvisgnnNIGGD 107
                         345555678899999*************************9999988774444433331111456633.4566555433355566666765 PP

              NOZZLE 123 rilcg.gvgsgqvmidpvispwgfvetsatthelssisnpqmynassnnrcdtcfkkkrldgdqnnvvrsngggfskytmipppmngyde. 211
                          i+    vg g     p +     +ets    elssi+n      s  +  d c+kk r++ d++    sn         +    ng+d  
  Phvul.005G087800.1 108 WIVPNrVVGNGSYGSGPPLLVGTPLETSK---ELSSIPNLH----SQPECFDFCLKKTRFNEDNE--KGSNARR---ERTLEIWPNGHDFl 186
                         55443135666666666555555677776...*****9964....5556569*********9983..3444443...33333333666651 PP

              NOZZLE 212 .yllqsdhhq..rsqgflydqriaraasvsa.asasinpyfne..atnltgsreefgsvl..egnprngsrgv..keyeffp.gkydervs 291
                          ++ qs   +       +yd ++ar  s sa a a+ n    e  a    g+      ++  e  p +  rg   ke ef   g      +
  Phvul.005G087800.1 187 gFMPQSSVSNlvGETSDFYD-KLARHDSASAyACATPNDECVEvvAVHRRGNSTSGRVFMeyEFFPGKDGRGTtsKELEFPTtGSVAVGSG 276
                         14444443221123445777.5788776555244555655555222333343322222331133454444443125666532133322222 PP

              NOZZLE 292 .kvakvaslvgdcspntidlslkl 314
                           +  +a++ gd + n idlslkl
  Phvul.005G087800.1 277 eASSITAAAYGDSASNYIDLSLKL 300
                         134556778899999999999997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF087442.0E-1118280IPR014855Plant transcription factor NOZZLE
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MASEHNMFHE EEGKDEAGRS RSRSRRTNGK GPKKPPQRGL GVAQLERLRI QESWKKMSEG  60
SSGVLPVTAL HDHHQQQLFQ RHPSPNLGFQ FQCPQHVISG NNNIGGDWIV PNRVVGNGSY  120
GSGPPLLVGT PLETSKELSS IPNLHSQPEC FDFCLKKTRF NEDNEKGSNA RRERTLEIWP  180
NGHDFLGFMP QSSVSNLVGE TSDFYDKLAR HDSASAYACA TPNDECVEVV AVHRRGNSTS  240
GRVFMEYEFF PGKDGRGTTS KELEFPTTGS VAVGSGEASS ITAAAYGDSA SNYIDLSLKL  300
SR*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.005G087800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007149653.10.0hypothetical protein PHAVU_005G087800g
TrEMBLV7BUH90.0V7BUH9_PHAVU; Uncharacterized protein
STRINGXP_007149653.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF83651723
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27330.17e-07sporocyteless (SPL)