PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.005G040000.1
Common NamePHAVU_005G040000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family HD-ZIP
Protein Properties Length: 378aa    MW: 41895.3 Da    PI: 6.0708
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.005G040000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.21.2e-17195249256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Phvul.005G040000.1 195 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 249
                         788899***********************************************98 PP

2HD-ZIP_I/II1284e-41195285192
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         +kk+rlskeq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +l
  Phvul.005G040000.1 195 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELR-AL 284
                         69*************************************************************************************9.55 PP

         HD-ZIP_I/II  92 k 92 
                         k
  Phvul.005G040000.1 285 K 285
                         5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-18178245IPR009057Homeodomain-like
SuperFamilySSF466891.07E-18182252IPR009057Homeodomain-like
PROSITE profilePS5007117.103191251IPR001356Homeobox domain
SMARTSM003891.9E-15193255IPR001356Homeobox domain
CDDcd000862.28E-15195252No hitNo description
PfamPF000464.0E-15195249IPR001356Homeobox domain
PROSITE patternPS000270226249IPR017970Homeobox, conserved site
SMARTSM003409.1E-26251294IPR003106Leucine zipper, homeobox-associated
PfamPF021835.9E-11251285IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MELGLSLGDS SRPLLAFMEK PREASNQPGL GFTTALSIGP LIARQKDQQD EFEEEEEEEE  60
TKPRNNNNSI NTHTTEDPSK PNNNPVLHQL DLLPQLYLPW HPPSENGSLS SELGGSSRGL  120
DVNAQPPLAE DEGEEVAALS SSPNSAASSF QMDLCIYNRG GSFYKRNYEG EAYDQRASPR  180
ASDEDDNNGS GGNARKKLRL SKEQSAFLEE SFKEHNTLNP KQKLALAKQL NLRPRQVEVW  240
FQNRRARTKL KQTEVDCEYL KRCCETLTEE NRRLHKELQE LRALKTSNPF YMQLPATTLT  300
MCPSCERVAT NSTSTSSSLS APNATINANS GAMTIVKTSG SNNDSPSKAM GFPFGKPRFH  360
PFVHTSQQPH QHQSPSS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1243251RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.005G040000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150401e-176AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007149086.10.0hypothetical protein PHAVU_005G040000g
SwissprotA2YW035e-87HOX27_ORYSI; Homeobox-leucine zipper protein HOX27
TrEMBLV7BVK40.0V7BVK4_PHAVU; Uncharacterized protein
STRINGXP_007149086.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.15e-65homeobox from Arabidopsis thaliana