PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.004G157100.1
Common NamePHAVU_004G157100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family LBD
Protein Properties Length: 294aa    MW: 32004.9 Da    PI: 9.5477
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.004G157100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26052.11.9e-16831622099
              DUF260  20 pyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                         ++ p++q++++ +++k++G++ +l+ll+++p + ++++++ l+yeA+ r+ dPv G++g++++++++l++++a ++l ++
  Phvul.004G157100.1  83 EICPESQSNATLFLAKFYGRQGLLNLLSDAPSHLQPAVFKYLLYEACGRMVDPVFGSTGLLSTGNWHLCEAAATAVLSGA 162
                         55699******************************************************************999887665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508919.7563164IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-1281157IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MVLQITQIQM KVRVCVNSRR LGRETRKQKE KVVCVLFMRC RLFQIQCSLR VYRSGSHSHP  60
KPLAAPTVPH RNLDFMNSLV VKEICPESQS NATLFLAKFY GRQGLLNLLS DAPSHLQPAV  120
FKYLLYEACG RMVDPVFGST GLLSTGNWHL CEAAATAVLS GAPIQQALLD IRHVAKSHKS  180
CGPDSLHRVK SQTSKFKRRP AKPKVDSTVA ELAESELDGQ GSLSHDSVSG LTRTSENKIV  240
GGEADSSCSE NVVEPAATND GEIELQLTLG WGPVKKSTTV MLPRVGINLS GNT*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.004G157100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150447e-87AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007152759.10.0hypothetical protein PHAVU_004G157100g
TrEMBLV7C5X40.0V7C5X4_PHAVU; Uncharacterized protein
STRINGXP_007152759.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1818944
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02550.11e-41LOB domain-containing protein 41