PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.004G146800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family G2-like
Protein Properties Length: 393aa    MW: 43321.6 Da    PI: 7.7925
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.004G146800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.33e-32222275255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt+ LH+rFv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Phvul.004G146800.1 222 PRMRWTSSLHNRFVHAVQLLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 275
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.27E-15219276IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.9E-29220276IPR009057Homeodomain-like
TIGRFAMsTIGR015573.5E-24222275IPR006447Myb domain, plants
PfamPF002492.6E-7223274IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MPQNKIFREQ SSNQIPDLSL HISLPNSAPS SICSGGDSPF DTWPQQADDD DAEGFKSHSD  60
GSIKDTQLSL ANSTSAVTAA APSEAETTWR KRNLVGLSHH RVSEAQIRLI NGIPLYSNLS  120
NNSATVPSID RSPTNKFSFS SLYAVPHPPC SANSAPNYSY NGAVGGVAGE PISRPQQFQY  180
FDYPQQQFGN STNFGASEFP NGFVRSRMLP RQQSNKRNMR APRMRWTSSL HNRFVHAVQL  240
LGGHERATPK SVLELMDVKD LTLAHVKSHL QMYRTVKNTD KPAASSDGDE DFMSLTVPNN  300
QNKNFLPNQR GASMDCDMGY TSSNLWANSS TSRGARIQAS SLDLDKLSHQ EILSSQHNSE  360
GNNYTQTRSF KDQNPSLEFS LGRSTWHNNE HA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-17223277458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-17223277458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-17223277357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-17223277357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-17223277357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-17223277357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-17223277458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-17223277458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-17223277458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-17223277458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-17223277458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-17223277458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.004G146800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150442e-84AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007152641.10.0hypothetical protein PHAVU_004G1468001g, partial
TrEMBLV7C5U00.0V7C5U0_PHAVU; Uncharacterized protein (Fragment)
STRINGXP_007152641.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.12e-51G2-like family protein