PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.004G120500.1
Common NamePHAVU_004G120500g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family HD-ZIP
Protein Properties Length: 744aa    MW: 81810.1 Da    PI: 5.6587
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.004G120500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.81.4e-2156111156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         ++k +++t++q++ Le++F+++++p++++r++L+k+lgL+ +qVk+WFqNrR+++k
  Phvul.004G120500.1  56 KKKYHRHTPQQIQDLEAFFKECPHPDEKQRTDLSKRLGLENKQVKFWFQNRRTQMK 111
                         79999************************************************999 PP

2START167.31.1e-522684902205
                         HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
               START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                         +a  a++elvk+a  + p+W kss    e +n +e+  +f++  v      + +ea ra+gvv + +  lve+++d+  +W+e++     +
  Phvul.004G120500.1 268 IAINAMDELVKMARQDNPLWIKSSdgrnEVLNCEEYAGIFPTF-VgtkpagYVTEATRATGVVLASSLGLVETFMDVD-RWSEMFSsmvaS 356
                         57789*******************999999999*******774.35999*****************************.*****999999* PP

                         EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEE CS
               START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghs 162
                         a tl+v+ssg      galq+m ae+q+lsplvp R   f+R+++q+ +g+wv+vdvSvd  ++  +s++++ +++lpSg++i+++ ng s
  Phvul.004G120500.1 357 ACTLDVLSSGtngtrnGALQVMLAEFQLLSPLVPtRQLSFLRFCKQHAEGVWVVVDVSVDIIRNAANSHPLMSCKRLPSGCIIQDMTNGLS 447
                         ****************************************************************999************************ PP

                         EEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
               START 163 kvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                         k+twveh  +++ ++h+l r+lv+sg+ +ga++w a l rqc 
  Phvul.004G120500.1 448 KITWVEHSQYDEGVIHQLCRPLVSSGIGFGAQRWIASLLRQCD 490
                         **************************************99996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.43E-2037113IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.5E-2242107IPR009057Homeodomain-like
PROSITE profilePS5007117.86453113IPR001356Homeobox domain
SMARTSM003893.3E-1855117IPR001356Homeobox domain
CDDcd000862.60E-1856113No hitNo description
PfamPF000463.7E-1956111IPR001356Homeobox domain
PROSITE patternPS00027088111IPR017970Homeobox, conserved site
PROSITE profilePS5084844.696258494IPR002913START domain
SuperFamilySSF559611.51E-29261491No hitNo description
CDDcd088752.59E-96262489No hitNo description
SMARTSM002349.6E-36267491IPR002913START domain
PfamPF018521.6E-44268490IPR002913START domain
Gene3DG3DSA:3.30.530.207.7E-4321458IPR023393START-like domain
SuperFamilySSF559616.46E-14513707No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 744 aa     Download sequence    Send to blast
MEGRSEMGLI GESFDTSNLL GRLRDDDYES RSESDNFDGG SGDDQDVGDD QPQRKKKKYH  60
RHTPQQIQDL EAFFKECPHP DEKQRTDLSK RLGLENKQVK FWFQNRRTQM KTQLERHENM  120
VLKQENDKLR AENGVMKEAL ANPICNNCGG PAIPGQISLE EHQTRIENAR LKDELNRICT  180
LANKFLGRSL SSLATPMSLP PTNAGLELAI GRNGIGGSSN FGMPLPIGFE VGDGGLGSSP  240
AMQSMAARVP VGMMGNEIHL ERSMLIDIAI NAMDELVKMA RQDNPLWIKS SDGRNEVLNC  300
EEYAGIFPTF VGTKPAGYVT EATRATGVVL ASSLGLVETF MDVDRWSEMF SSMVASACTL  360
DVLSSGTNGT RNGALQVMLA EFQLLSPLVP TRQLSFLRFC KQHAEGVWVV VDVSVDIIRN  420
AANSHPLMSC KRLPSGCIIQ DMTNGLSKIT WVEHSQYDEG VIHQLCRPLV SSGIGFGAQR  480
WIASLLRQCD CLAILMSPPA PSDDPIVLSQ SNRRSIMKLA QRMTECFCSG ICASSARKWD  540
VLHIGSLADD MKIMARKTVD DPNEAPGIVL SASTSVWMPV SRQRVFDFLR NEQLRGEWDM  600
LSKGGPMKEM LHVPKGQEHG NCVSILHYAN NESNMFYLQE SWTDASGSMV VYSPINMQSL  660
NMMMNCGDSS FVALRPSGFA ILPDGHSNNS DNNDGGGSCL LTVGLQMLQN DNQSAKFTME  720
SVQTVNSLLS CTIQKVKEAL GVS*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.004G120500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007152327.10.0hypothetical protein PHAVU_004G120500g
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLV7C5Y80.0V7C5Y8_PHAVU; Uncharacterized protein
STRINGXP_007152327.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]