PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.004G114100.1
Common NamePHAVU_004G114100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family Nin-like
Protein Properties Length: 981aa    MW: 109317 Da    PI: 6.1295
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.004G114100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.14.1e-29574625152
              RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         aek+isl++l++yF +++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rkik++
  Phvul.004G114100.1 574 AEKSISLDVLQHYFTGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKIKKV 625
                         589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.245562645IPR003035RWP-RK domain
PfamPF020424.5E-25578625IPR003035RWP-RK domain
Gene3DG3DSA:3.10.20.2402.1E-27881962No hitNo description
PROSITE profilePS5174522.936881963IPR000270PB1 domain
SMARTSM006662.8E-24881963IPR000270PB1 domain
SuperFamilySSF542778.83E-23881966No hitNo description
CDDcd064071.08E-35882962No hitNo description
PfamPF005641.6E-19882962IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 981 aa     Download sequence    Send to blast
MSESKEENPD LLPKSKQQEE HGFAMDFDIG FESLWSLDHI SLVSNPMSPF LLSTISEQPF  60
SPIWAFDVED ERQIRIATAG NTKAATENPV ESYENKKTVS PPFVAVPPSE NPDGYCLIKE  120
RMTQALRHFK ELTEQNVLAQ VWAPVRNGNR YALTTSGQPF VLDPHSNGLY QYRTASLMYM  180
FSVDGENDEI LGLPGRVFQH RIPEWTPNVQ YYSSKEYQRL NHAQHYNVRG TLALPVFEPA  240
GQSCVAVLEL IMTSPKINYA PEVDKICKAL EAVNLRSSEI LEHPYNQICN EDRQYALAEI  300
LEILTVVCET HSLPLAQTWV PCEHRSVLAH GGGHKKSCSS FDGCCMGQVC MSITDVAFYV  360
IEAHTWGFHE ACVEHHLQQG QGVAGRAFLS HNMCFCGNIT QFCKTEYPLV HYALMFGLTS  420
SFAVCLQSSH TGNDEYVLEF FLPPRITDFN EQKRLLGSIL ATMKPHFQSL KIAAGVELEQ  480
NCSIEIIEAR KEGVQLRFES IPITQSSKSP PRHASPNMGE RLPPAPSEQQ IMVDFDDIND  540
GKNLGDTAGG HIDQNTSLEA RTKKKPSERK RGKAEKSISL DVLQHYFTGS LKDAAKSLGV  600
CPTTMKRICR QHGISRWPSR KIKKVNRSLS KLKCVIESVH GAEGAFGLNS LSTGSFPSTS  660
NKFNRQTSLT IRPSEPKINE NDFDASRASE SNRQAGVEDH FLSTRTQNPE KVINEKVVAI  720
QETGTKGTTR FRTGSGSSEE SANPSPRGSC QGSPPNEMSP PKDIFVTGIS EQCHVLRGSL  780
GSTLYSTSTP NRATAYPMPN NFVEITEPQE PFGGQLLEGV GSSKDLRNLC PSADAVLEDQ  840
VHEHWRMNHQ CSELTPVQHM DTLNNNNNNM TPFAVRKEVK SVTIKATYRE DIIRFKISLN  900
CAIVELKEEI DKRLKLEEGT FDIKYLDDDH EWVLIACDAD LQECMDISRS SGSNMIRLVV  960
HDILPILGSS CESSGDWKGC *
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in regulation of nitrate assimilation and in transduction of the nitrate signal. {ECO:0000269|PubMed:18826430}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.004G114100.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not regulated by the N source or by nitrate. {ECO:0000269|PubMed:18826430}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007152252.10.0hypothetical protein PHAVU_004G114100g
SwissprotQ84TH90.0NLP7_ARATH; Protein NLP7
TrEMBLV7C5S40.0V7C5S4_PHAVU; Uncharacterized protein
STRINGXP_007152252.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42573456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7
Publications ? help Back to Top
  1. Xu N, et al.
    The Arabidopsis NRG2 Protein Mediates Nitrate Signaling and Interacts with and Regulates Key Nitrate Regulators.
    Plant Cell, 2016. 28(2): p. 485-504
    [PMID:26744214]
  2. Karve R,Suárez-Román F,Iyer-Pascuzzi AS
    The Transcription Factor NIN-LIKE PROTEIN7 Controls Border-Like Cell Release.
    Plant Physiol., 2016. 171(3): p. 2101-11
    [PMID:27221617]
  3. Yu LH, et al.
    Overexpression of Arabidopsis NLP7 improves plant growth under both nitrogen-limiting and -sufficient conditions by enhancing nitrogen and carbon assimilation.
    Sci Rep, 2016. 6: p. 27795
    [PMID:27293103]
  4. Menz J,Li Z,Schulze WX,Ludewig U
    Early nitrogen-deprivation responses in Arabidopsis roots reveal distinct differences on transcriptome and (phospho-) proteome levels between nitrate and ammonium nutrition.
    Plant J., 2016. 88(5): p. 717-734
    [PMID:27419465]
  5. Yan D, et al.
    NIN-like protein 8 is a master regulator of nitrate-promoted seed germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 13179
    [PMID:27731416]
  6. Guan P, et al.
    Interacting TCP and NLP transcription factors control plant responses to nitrate availability.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(9): p. 2419-2424
    [PMID:28202720]
  7. Liu KH, et al.
    Discovery of nitrate-CPK-NLP signalling in central nutrient-growth networks.
    Nature, 2017. 545(7654): p. 311-316
    [PMID:28489820]
  8. Li Z, et al.
    The Arabidopsis CPSF30-L gene plays an essential role in nitrate signaling and regulates the nitrate transceptor gene NRT1.1.
    New Phytol., 2017. 216(4): p. 1205-1222
    [PMID:28850721]
  9. Cao H, et al.
    Overexpression of the Maize ZmNLP6 and ZmNLP8 Can Complement the Arabidopsis Nitrate Regulatory Mutant nlp7 by Restoring Nitrate Signaling and Assimilation.
    Front Plant Sci, 2017. 8: p. 1703
    [PMID:29051766]
  10. Konishi N,Okubo T,Yamaya T,Hayakawa T,Minamisawa K
    Nitrate Supply-Dependent Shifts in Communities of Root-Associated Bacteria in Arabidopsis.
    Microbes Environ., 2017. 32(4): p. 314-323
    [PMID:29187692]
  11. Karve RA,Iyer-Pascuzzi AS
    Further insights into the role of NIN-LIKE PROTEIN 7 (NLP7) in root cap cell release.
    Plant Signal Behav, 2018. 13(1): p. e1414122
    [PMID:29215953]
  12. Zhao L, et al.
    The Arabidopsis NLP7 gene regulates nitrate signaling via NRT1.1-dependent pathway in the presence of ammonium.
    Sci Rep, 2018. 8(1): p. 1487
    [PMID:29367694]