PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.004G052300.1
Common NamePHAVU_004G052300g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family GeBP
Protein Properties Length: 399aa    MW: 44396.1 Da    PI: 10.0515
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.004G052300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57398.46.6e-31173268196
              DUF573   1 klfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifel 91 
                         klfqr+ws eDe+ +L+G+++f + tg++p+   daf++f+kks+++++s+ ql eKirr+Kk+ k++ +++++gkep++ k+hdq  fe+
  Phvul.004G052300.1 173 KLFQRIWSPEDEVGILKGILEFISMTGQDPYRYADAFHSFIKKSLHVEFSSLQLKEKIRRMKKRCKTHLERQAEGKEPRLLKPHDQTLFEF 263
                         579**************************************************************************************** PP

              DUF573  92 skkiW 96 
                         skkiW
  Phvul.004G052300.1 264 SKKIW 268
                         ***** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045044.8E-28175268IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MPQKRKKRPP PPIEDPPTAS SSESEEGDDR PRSSQPHAAA AAPPPVAAAQ VSSSEDEDDS  60
SEEDKKQRST LPASANPPSN AHPKSSFSES DTDSEPTRAK SKSKPKPKSK PTDQLQPQDQ  120
AQRSSAQVKP VSKRSIHKTD PKRLKKKRAD APSSSVANDA TEEDGNKSGS QAKLFQRIWS  180
PEDEVGILKG ILEFISMTGQ DPYRYADAFH SFIKKSLHVE FSSLQLKEKI RRMKKRCKTH  240
LERQAEGKEP RLLKPHDQTL FEFSKKIWID WPNGLVEKPK FNGKGRKPKK KESATTSVPK  300
AKDNVLPQPS APLLALPAPG EYDSGDVSLL YRKISCFEEL DADEMKRGLT LIGESKRKEL  360
ERRWNMLVHS EMELLANRSL LIGEQIKLIS EALQSSSN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.004G052300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007151503.10.0hypothetical protein PHAVU_004G052300g
TrEMBLV7BZZ00.0V7BZZ0_PHAVU; Uncharacterized protein
STRINGXP_007151503.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00390.12e-20DNA-binding storekeeper protein-related transcriptional regulator