PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.004G027500.1
Common NamePHAVU_004G027500g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family HD-ZIP
Protein Properties Length: 276aa    MW: 31732.5 Da    PI: 7.4078
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.004G027500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.32.7e-1882134456
                         -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         + +++ eq+++Le+ Fe  +++  e++ +LAk lgL+ rq+ +WFqNrRa++k
  Phvul.004G027500.1  82 KKRLSLEQVKALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWK 134
                         556899**********************************************9 PP

2HD-ZIP_I/II128.62.6e-4180172193
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekk+rls eqvk+LE+sFe  +kLeperK++la++Lglqprq+a+WFqnrRAR+ktkqlEk+ye+Lk++++a+k++n++L++++++L++el
  Phvul.004G027500.1  80 EKKKRLSLEQVKALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWKTKQLEKEYEVLKKQFEAVKADNDSLKAQNQKLHAEL 170
                         69***************************************************************************************99 PP

         HD-ZIP_I/II  92 ke 93 
                         ++
  Phvul.004G027500.1 171 QN 172
                         86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.54E-1972138IPR009057Homeodomain-like
PROSITE profilePS5007117.15176136IPR001356Homeobox domain
SMARTSM003894.6E-1879140IPR001356Homeobox domain
CDDcd000861.97E-1581137No hitNo description
PfamPF000461.6E-1582134IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.7E-1983143IPR009057Homeodomain-like
PRINTSPR000319.4E-6107116IPR000047Helix-turn-helix motif
PROSITE patternPS000270111134IPR017970Homeobox, conserved site
PRINTSPR000319.4E-6116132IPR000047Helix-turn-helix motif
PfamPF021831.2E-14136176IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MAFPPSHTFM FQTHEDHDHH QLHLRSTSSS LNAFPSFPPH HFQGAGFMMK RSMSFSGIEN  60
KCDEVHGDDE LSDDGSQLGE KKKRLSLEQV KALEKSFELG NKLEPERKMQ LAKALGLQPR  120
QIAIWFQNRR ARWKTKQLEK EYEVLKKQFE AVKADNDSLK AQNQKLHAEL QNLKNRDCCE  180
TRTVSLKKET EGSWSNGSNN SSEINLDRTP VMNSPVSSQN GKSLVPTSLK PTSMTQLLQC  240
SSRSDLQDES FCNMFHNIDE QQNFWPWTEQ QHQFH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1128136RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.004G027500.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin. {ECO:0000269|PubMed:12644682}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007151217.10.0hypothetical protein PHAVU_004G027500g
SwissprotQ8LAT03e-81ATB20_ARATH; Homeobox-leucine zipper protein ATHB-20
TrEMBLV7C2W40.0V7C2W4_PHAVU; Uncharacterized protein
STRINGXP_007151217.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01220.13e-78homeobox protein 20