PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.004G010100.1
Common NamePHAVU_004G010100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family LBD
Protein Properties Length: 164aa    MW: 18421.6 Da    PI: 5.2462
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.004G010100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.64.5e-4310107198
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrrkC +dC +apyfp e+p+kf nvhk+FGasnv+k+l+++++ +red+++sl+yeAear++dPvyG+vg i+ lq+q+ +l+
  Phvul.004G010100.1  10 PCAACKFLRRKCMPDCLFAPYFPPEEPQKFVNVHKIFGASNVSKILNEVQPYQREDTVNSLAYEAEARIKDPVYGCVGAISVLQRQVLKLQ 100
                         7****************************************************************************************** PP

              DUF260  92 aelallk 98 
                         +el++++
  Phvul.004G010100.1 101 KELDATN 107
                         **99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.1259110IPR004883Lateral organ boundaries, LOB
PfamPF031956.4E-4310106IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MASSSYSNSP CAACKFLRRK CMPDCLFAPY FPPEEPQKFV NVHKIFGASN VSKILNEVQP  60
YQREDTVNSL AYEAEARIKD PVYGCVGAIS VLQRQVLKLQ KELDATNVDL IRYNTCNEMP  120
NSSNHHEGRS KIINDDDDLY YASSSTNWNN NPCDENGYPR GDI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-6331194119LOB family transfactor Ramosa2.1
5ly0_B2e-6331194119LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.004G010100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150441e-139AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007150999.11e-120hypothetical protein PHAVU_004G010100g
SwissprotQ8L8Q32e-66LBD25_ARATH; LOB domain-containing protein 25
TrEMBLV7C0U91e-119V7C0U9_PHAVU; Uncharacterized protein
STRINGXP_007150999.11e-119(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF109134112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.11e-68LOB domain-containing protein 25
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]