PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G283000.1
Common NamePHAVU_003G283000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family G2-like
Protein Properties Length: 338aa    MW: 37469.6 Da    PI: 9.7011
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G283000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.81.9e-31169222255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt++LH+rFv++v+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Phvul.003G283000.1 169 PRMRWTTTLHARFVHVVQLLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 222
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.09E-15166222IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-27167222IPR009057Homeodomain-like
TIGRFAMsTIGR015576.2E-23169222IPR006447Myb domain, plants
PfamPF002495.2E-7170221IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MELFPAQPDL SLQITPPNSK STSSNWKRST EEEMDLGFWK RALESKTTTS LVKTNTSLVK  60
TDLSLSNPRP SSSNTNIPNT NTNLIHHFQN NINNNNGNNP IQQNHFFQQD LGFLRPIRGI  120
PVYQNPSLSF PHPHAPSNTP TPSNPFLSQP LINSRFLSRF PPKRHMRAPR MRWTTTLHAR  180
FVHVVQLLGG HERATPKSVL ELMDVKDLTL AHVKSHLQMY RTVKTTDRAA ASSGQCDAYD  240
NGSSGDTSEE SPRIKQARTS VNEDNENGGL WDNSSSREAW LHGKPKVDSI GNVPSVEGMD  300
PKGQSNEISD GNSSSNTPET SAKKPNLDLE FTLGRSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-16170224458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-16170224458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-16170224357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-16170224357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-16170224357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-16170224357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-16170224458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-16170224458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-16170224458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-16170224458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-16170224458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-16170224458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates lateral organ polarity. Promotes abaxial cell fate during lateral organd formation. Functions with KAN1 in the specification of polarity of the ovule outer integument. {ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.003G283000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150343e-43AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007156399.10.0hypothetical protein PHAVU_003G283000g
SwissprotQ9C6163e-81KAN2_ARATH; Probable transcription factor KAN2
TrEMBLV7CGA80.0V7CGA8_PHAVU; Uncharacterized protein
STRINGXP_007156399.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59683452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.13e-63G2-like family protein
Publications ? help Back to Top
  1. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]