PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G258900.1
Common NamePHAVU_003G258900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family GATA
Protein Properties Length: 382aa    MW: 42344.8 Da    PI: 7.7643
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G258900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.61.7e-18299333135
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                         Cs+Cg+ kTp+WR gp g ktLCnaCG++y++ +l
  Phvul.003G258900.1 299 CSHCGVQKTPQWRTGPLGAKTLCNACGVRYKSGRL 333
                         *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577161.62E-14291355No hitNo description
SMARTSM004012.1E-16293347IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.939293329IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.7E-14297331IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.69E-13298346No hitNo description
PfamPF003202.2E-16299333IPR000679Zinc finger, GATA-type
PROSITE patternPS003440299324IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MVMVVVVVVV ERVERVESDK AEGKVRLGSS KVYLLFIIYC WGKERGTFQP SFNDALTNSP  60
SSTLSLFLFL FQFHPSSLPS LLSQFKVAME CLEAVLKSSF RKDMSLKLSP QAFPEDLNMQ  120
NVTACDDFFV DDLLDFSLLE NEEPDQHKHN HHSTSVSPHN SNHDSYNCNP SFNDNFNTEL  180
TLPAEEVADL EWVSHFIEDS FSKYSLSFPA TVSQSLAEKP PEPGNAGFTF KTLVPAKPRS  240
KRTRTGVRVW PLRSPSSFTD TSSPSSPLLI CAAASKDHHP EDKRAKKRAA PDGGAARRCS  300
HCGVQKTPQW RTGPLGAKTL CNACGVRYKS GRLLPEYRPA CSPTFSSELH SNHHRKVLEM  360
RQKKEAEPGP DTGSPPSVPG F*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007156103.10.0hypothetical protein PHAVU_003G258900g
SwissprotQ9FH574e-67GATA5_ARATH; GATA transcription factor 5
TrEMBLV7CD190.0V7CD19_PHAVU; Uncharacterized protein
STRINGGLYMA02G05710.21e-126(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.28e-64GATA transcription factor 5