PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G246900.1
Common NamePHAVU_003G246900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family G2-like
Protein Properties Length: 362aa    MW: 40513.4 Da    PI: 6.3584
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G246900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1031.8e-32226281156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W+peLH+rFv+a++qLGG+++AtPk+i+elm+v gLt+++vkSHLQkYRl+
  Phvul.003G246900.1 226 KQRRCWSPELHRRFVDALQQLGGPQVATPKQIRELMQVVGLTNDEVKSHLQKYRLH 281
                         79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.499223283IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.6E-29224284IPR009057Homeodomain-like
SuperFamilySSF466893.04E-18224284IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-26226281IPR006447Myb domain, plants
PfamPF002493.5E-8228279IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MELSLDLSLA FVPGRTVCQI LGEVAQSEDG SQRTPTLEDF LQKLEDEKRK IDSFKRELPL  60
CMLLVNDAIT KLKEEINGGV RMHEEPVVEE YIPLMKTNSE GSETLSMDTE RSNMKNWINS  120
VRLWNVESKP RNEEDGRCVP NNPNQAQNET NKSRGAPLAL NGNNRVSKTV MSEDKGVSQI  180
PSLGLMRPVF ELNNRKTESG NEHGSSLITS SSEIKCEAPP QQNPRKQRRC WSPELHRRFV  240
DALQQLGGPQ VATPKQIREL MQVVGLTNDE VKSHLQKYRL HFRRPQVSSF GHANSELCLM  300
VQDKGGDNNK SRGNLSQSGS PQGPLFLGGS GRNSMDTEED EHSDCHNWKG GLHHQPEAEL  360
L*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.003G246900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150341e-132AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007155959.10.0hypothetical protein PHAVU_003G246900g
TrEMBLV7CF130.0V7CF13_PHAVU; Uncharacterized protein
STRINGXP_007155959.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.17e-55G2-like family protein