PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G246800.1
Common NamePHAVU_003G246800g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family LBD
Protein Properties Length: 177aa    MW: 19594.5 Da    PI: 7.3385
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G246800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260113.41.5e-3531021100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +C aCk++rr+C +dC +apyfpae+ ++fa+vh++FG  nv+++lk++++e r+ ++++l+y+Aear+rdPv+G+vgvi + ++ l+ lk
  Phvul.003G246800.1   3 PCGACKYQRRRCGADCLMAPYFPAESIQRFAYVHHVFGGGNVSNILKSTKPELRKWTARALTYQAEARVRDPVHGCVGVICEQEESLRILK 93 
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         ++l+++k+e
  Phvul.003G246800.1  94 EKLEKAKRE 102
                         ***999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.1972103IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-343100IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MTPCGACKYQ RRRCGADCLM APYFPAESIQ RFAYVHHVFG GGNVSNILKS TKPELRKWTA  60
RALTYQAEAR VRDPVHGCVG VICEQEESLR ILKEKLEKAK REVAKYVGPE VMQKMIEQCS  120
SYPHANMVDL EAPLAITIDD ADLSSWDPFP AWEPAFSRLQ PPQGGDAKGE TIAPPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-28310611114LOB family transfactor Ramosa2.1
5ly0_B1e-28310611114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.003G246800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007155958.11e-130hypothetical protein PHAVU_003G246800g
TrEMBLV7CCN11e-129V7CCN1_PHAVU; Uncharacterized protein
STRINGXP_007155958.11e-130(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1945945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.12e-36ASYMMETRIC LEAVES 2-like 1