PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G246700.1
Common NamePHAVU_003G246700g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family LBD
Protein Properties Length: 274aa    MW: 30406.4 Da    PI: 6.4116
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G246700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.88e-4371061100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrrkC+++Cv+apyfp ++p++f++vh++FGasnv+kll++l+  +r+da++sl+yeAear+rdPvyG+vg+i+ lqq+l+q +
  Phvul.003G246700.1   7 PCAACKLLRRKCTQECVFAPYFPPDNPQRFECVHRVFGASNVSKLLNELSVAQRDDAVKSLAYEAEARLRDPVYGCVGLISLLQQRLRQIQ 97 
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                          el+ +k+e
  Phvul.003G246700.1  98 MELHIAKKE 106
                         ****99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.1156107IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-427104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MSSMNSPCAA CKLLRRKCTQ ECVFAPYFPP DNPQRFECVH RVFGASNVSK LLNELSVAQR  60
DDAVKSLAYE AEARLRDPVY GCVGLISLLQ QRLRQIQMEL HIAKKEFSTY VSPQTMQILL  120
ANPGMVPPAE IVGPPPHQPM FNHGGNNMVP QQILVGHGGG QTVVRDPQQQ DFQEAQQIIL  180
ATREQQQMFR NYEHQVYGGF EPGNGGFGNQ AELLSPSLAH GNFGNVGAYQ MQQQGEQHPI  240
EAQLLLSPQQ GQPHQQQQCE SEDGRNVLDF SIK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-44612310127LOB family transfactor Ramosa2.1
5ly0_B1e-44612310127LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.003G246700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007155957.10.0hypothetical protein PHAVU_003G246700g
TrEMBLV7CGA40.0V7CGA4_PHAVU; Uncharacterized protein
STRINGXP_007155957.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.13e-51ASYMMETRIC LEAVES 2-like 1