PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G236300.1
Common NamePHAVU_003G236300g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family GRAS
Protein Properties Length: 471aa    MW: 52463.8 Da    PI: 5.9548
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G236300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS293.65.2e-90534672373
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl..fsevsPi 90 
                         ++lL++cA+a++++d +laq++L+ l+++aspdgd++qRla+ f++AL ar a+ ++ l++     +t+ +  ++++++ +l  f++++P+
  Phvul.003G236300.1  53 EQLLVHCANAIQTNDVTLAQQILWVLNNIASPDGDSNQRLASSFLRALTARAAQ-TKMLVAVADHDRTNLSIDTHKFSVIELanFVDLTPW 142
                         79***************************************************9.44444333333333333555555556588******* PP

                GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerLakfAeelgvpfe 177
                         ++f++ +aN a+l a+eg + +Hi+D+++++++Q p+L++a+asR e +p +++T+ ++   +       ++ e+g +L +fA++ +v +e
  Phvul.003G236300.1 143 HRFGFTAANAAVLAATEGFSVIHIVDLSLTHCMQIPTLIDAIASRHEVTPLIKLTVADATCRDippmLDLSYDELGAKLINFARSRNVVME 233
                         *********************************************************9987779987788999****************** PP

                GRAS 178 fnvl...vakrledleleeLrvkp...........gEalaVnlvlqlhrll...........................desvsleserdev 227
                         f+v+   + + ++   +e+Lrv++            Eal++n++++lh+++                            + +s++s r+ +
  Phvul.003G236300.1 234 FRVVsstYQDGFAG-LIEQLRVQQqhfvyaaeprsCEALVINCHMMLHYIPdeslhaipetdlasllydsssaaassaVSVTSTSSLRSLF 323
                         ***74432333333.489999988888889999999***************************************98533334444788** PP

                GRAS 228 LklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrer 318
                         Lk +++l P+vv++v+++ad++s++++ r+ +a++y +  +d++++ lpr s++r+++E+  + ++i+nv+a+eg er+er e + +W++r
  Phvul.003G236300.1 324 LKSLRGLDPTVVILVDEDADLTSNNLVCRLRSAFNYLWIPYDTVDTFLPRGSKQRQWYEAD-ICWKIENVIAHEGIERVERVEPKTRWEQR 413
                         *************************************************************.***************************** PP

                GRAS 319 leeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                         +++a F+ v++s++ ++++k +l +++  g+ ++ e++ ++l+Wk++++v++SaW
  Phvul.003G236300.1 414 MKNANFQGVAFSDDSVAEVKGMLDEHA-AGWGLKREDEHILLTWKGHNVVFASAW 467
                         ***************************.999************************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.87726449IPR005202Transcription factor GRAS
PfamPF035141.8E-8753467IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MTQFTPQLPP FHQITPLPNP TMNKNQIPRT RPWPAGFPTS KALTNFGDAN CMEQLLVHCA  60
NAIQTNDVTL AQQILWVLNN IASPDGDSNQ RLASSFLRAL TARAAQTKML VAVADHDRTN  120
LSIDTHKFSV IELANFVDLT PWHRFGFTAA NAAVLAATEG FSVIHIVDLS LTHCMQIPTL  180
IDAIASRHEV TPLIKLTVAD ATCRDIPPML DLSYDELGAK LINFARSRNV VMEFRVVSST  240
YQDGFAGLIE QLRVQQQHFV YAAEPRSCEA LVINCHMMLH YIPDESLHAI PETDLASLLY  300
DSSSAAASSA VSVTSTSSLR SLFLKSLRGL DPTVVILVDE DADLTSNNLV CRLRSAFNYL  360
WIPYDTVDTF LPRGSKQRQW YEADICWKIE NVIAHEGIER VERVEPKTRW EQRMKNANFQ  420
GVAFSDDSVA EVKGMLDEHA AGWGLKREDE HILLTWKGHN VVFASAWLPA *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B5e-463446966474Protein SHORT-ROOT
5b3h_B2e-463446912420Protein SHORT-ROOT
5b3h_E2e-463446912420Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.003G236300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007155843.10.0hypothetical protein PHAVU_003G236300g
SwissprotQ9SN221e-172SCL32_ARATH; Scarecrow-like protein 32
TrEMBLV7CCB90.0V7CCB9_PHAVU; Uncharacterized protein
STRINGXP_007155843.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77023347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-161GRAS family protein