PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G232000.1
Common NamePHAVU_003G232000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family HD-ZIP
Protein Properties Length: 300aa    MW: 33099.4 Da    PI: 8.4947
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G232000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.51.1e-18153207256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         rk+ ++tkeq   Lee F+++++++ ++++ LAk+l+L  rqV vWFqNrRa+ k
  Phvul.003G232000.1 153 RKKLRLTKEQSALLEESFKQHSTLNPKQKQALAKQLSLRPRQVEVWFQNRRARTK 207
                         788899***********************************************98 PP

2HD-ZIP_I/II124.16.6e-40153242191
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         +kk+rl+keq++lLEesF+++++L+p++K++la++L l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en+rL+ke +eL+ +l
  Phvul.003G232000.1 153 RKKLRLTKEQSALLEESFKQHSTLNPKQKQALAKQLSLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELK-AL 242
                         69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.72E-18143210IPR009057Homeodomain-like
PROSITE profilePS5007117.394149209IPR001356Homeobox domain
SMARTSM003892.0E-15151213IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.4E-17153207IPR009057Homeodomain-like
PfamPF000465.0E-16153207IPR001356Homeobox domain
CDDcd000868.94E-16153210No hitNo description
PROSITE patternPS000270184207IPR017970Homeobox, conserved site
SMARTSM003402.8E-25209252IPR003106Leucine zipper, homeobox-associated
PfamPF021835.8E-10209243IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MMGLHQDPSD SGLQLILGLA LTATPEDTIT PSPPSISNNL HHHHLTTLRP NSYSSKSSFI  60
STSNSEPEPS LTLGLSRETY RQQVVKLPRN IGHNKVSSED PLEQTSPHSA ISSFSSGRVK  120
RERDLSCEEA DATETERVSS RASDEEEDGT TARKKLRLTK EQSALLEESF KQHSTLNPKQ  180
KQALAKQLSL RPRQVEVWFQ NRRARTKLKQ TEVDCEFLKK CCETLTDENR RLQKELQELK  240
ALKLAQPLYM PMSAATLTMC PACERLGGGV GGGASAKSPF SMAPKPHFFN PFANPSAAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1201209RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.003G232000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007155789.10.0hypothetical protein PHAVU_003G232000g
SwissprotP466046e-93HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLV7CEJ40.0V7CEJ4_PHAVU; Uncharacterized protein
STRINGXP_007155789.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.13e-81HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Liu T,Longhurst AD,Talavera-Rauh F,Hokin SA,Barton MK
    The Arabidopsis transcription factor ABIG1 relays ABA signaled growth inhibition and drought induced senescence.
    Elife, 2017.
    [PMID:27697148]
  3. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]