PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G194300.1
Common NamePHAVU_003G194300g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family LBD
Protein Properties Length: 301aa    MW: 34116.3 Da    PI: 5.7276
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G194300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260116.41.8e-36101091100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         aCaaCk++rrkC+++C lapyfpa+qpk f nvhklFG+sn++k+lk l+++++++am+s++ +A+ r + Pv+G+ + i +lq q+  ++
  Phvul.003G194300.1  10 ACAACKHQRRKCTSECLLAPYFPADQPKIFLNVHKLFGVSNIVKILKILEPNQKKIAMDSIIIQANYRDKYPVHGCWEEICRLQYQIWLAE 100
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         +el+++ ++
  Phvul.003G194300.1 101 EELHAVYQQ 109
                         ***999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.6799110IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-3510106IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MTLKGGTTQA CAACKHQRRK CTSECLLAPY FPADQPKIFL NVHKLFGVSN IVKILKILEP  60
NQKKIAMDSI IIQANYRDKY PVHGCWEEIC RLQYQIWLAE EELHAVYQQL EICRQQQQQQ  120
QQLPQHHHQG PPSMPDDVTS QLELGMTPCT NNNALSLFNH HTPQPNTYNN NVTALSVSQQ  180
HSYSNSNSMD YSSLYLDSKD NAINPLWVQY PCSNNDNSIG MQTPLVSSQP LAIQQNVVED  240
YVDMPPIFDS LDDRQSYIYS KEPYESSSEE SLKDIRKCTD HVSENELKSA AACFSLTSVN  300
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-2661107111LOB family transfactor Ramosa2.1
5ly0_B7e-2661107111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPhvul.003G194300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007155357.10.0hypothetical protein PHAVU_003G194300g
TrEMBLV7CEM20.0V7CEM2_PHAVU; Uncharacterized protein
STRINGXP_007155357.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.13e-46LOB domain-containing protein 27